CAZyme Information: MGYG000002456_00539

Basic Information

• Species: Methanomethylophilus alvus
• Lineage: Archaea; Thermoplasmatota; Thermoplasmata; Methanomassiliicoccales; Methanomethylophilaceae; Methanomethylophilus; Methanomethylophilus alvus
• CAZyme ID: MGYG000002456_00539
• CAZy Family: GT29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	MGYG000002456_1|CGC3	38677.64	6.1797

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002456	1666795	Isolate	United States	North America

• Gene Location: Start: 502046; End: 503041 Strand: -

Full Sequence      

MNYLEMTPSSLRVKIKSMWHSSGATSELLNIFKTISSINSYWKQMKNDVWLIYLCCLIEK
NEIDEFNKILIKYNKMYNMKDVERFLPLSHYLSQSTDLLKNIKVPYFFNDTLKKSNDVYE
KLKNNENLFTDLVKDKSIAIVGNSGCEIGLGRGNEIDSHDIVIRFNNYCIDGYEQDYGTK
TDIWVRGSAGEDIILRDPSNYKLIVWEADYDHFMVHFDNLDTLSKDLSNFPNKISNFNEE
THVKLRQLSGLKFPSTGALTVWATYLAKSNLNNVDVYGFSFIGNNYSDTNHYYGEESRLA
QDHDFENEIKFMHNFYFDHKRNGKELKKSDV

Enzyme Prediction     

No EC number prediction in MGYG000002456_00539.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT29	116	314	1.5e-20	0.8906882591093117

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00777	Glyco_transf_29	2.24e-20	106	313	20	255	Glycosyltransferase family 29 (sialyltransferase). Members of this family belong to glycosyltransferase family 29.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGI85280.1	2.82e-239	1	331	1	331
AYQ54704.1	1.05e-205	45	331	1	287
QGX90486.1	8.23e-55	42	297	133	379
API48892.1	1.98e-15	18	312	514	790
ATC11117.1	6.37e-15	118	299	579	760

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6APJ_A	9.89e-06	139	184	152	197	CrystalStructure of human ST6GALNAC2 [Homo sapiens],6APJ_B Crystal Structure of human ST6GALNAC2 [Homo sapiens],6APJ_C Crystal Structure of human ST6GALNAC2 [Homo sapiens],6APJ_D Crystal Structure of human ST6GALNAC2 [Homo sapiens],6APJ_E Crystal Structure of human ST6GALNAC2 [Homo sapiens],6APJ_F Crystal Structure of human ST6GALNAC2 [Homo sapiens]
6APL_A	9.89e-06	139	184	152	197	CrystalStructure of human ST6GALNAC2 in complex with CMP [Homo sapiens],6APL_B Crystal Structure of human ST6GALNAC2 in complex with CMP [Homo sapiens],6APL_C Crystal Structure of human ST6GALNAC2 in complex with CMP [Homo sapiens],6APL_D Crystal Structure of human ST6GALNAC2 in complex with CMP [Homo sapiens],6APL_E Crystal Structure of human ST6GALNAC2 in complex with CMP [Homo sapiens],6APL_F Crystal Structure of human ST6GALNAC2 in complex with CMP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2ZI41	1.37e-07	136	183	163	210	Sialyltransferase-like protein 2 OS=Oryza sativa subsp. indica OX=39946 GN=STLP2 PE=3 SV=1
Q2QXM3	1.37e-07	136	183	163	210	Sialyltransferase-like protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=STLP2 PE=2 SV=1
Q5K027	1.63e-07	136	207	282	359	Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Oryzias latipes OX=8090 GN=st6gal2 PE=2 SV=1
Q5QQ37	2.20e-06	136	207	310	387	Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Takifugu rubripes OX=31033 GN=st6gal2 PE=2 SV=1
Q92183	2.25e-06	79	184	273	386	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Gallus gallus OX=9031 GN=ST6GALNAC1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002456_00539.