CAZyme Information: MGYG000002454_00740

Basic Information

• Species: Akkermansia muciniphila
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila
• CAZyme ID: MGYG000002454_00740
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		38016.93	8.8428

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002454	2762447	Isolate	China	Asia

• Gene Location: Start: 891798; End: 892796 Strand: -

Full Sequence      

MNLKILSLVKSFPIFKIIFCILSAIPLIKAEDKIPFPIIENGNGASIYYSGENQIIHTAI
DILIKDSQYICRKEGISVTNSEKAGDILVGVIGEDKKFDTLCSQHCSKYKELKGKWETFL
IHPIRSHDNKKRLLIAGSDARGAAYGILELSRSMGISPWIWWADVIPEKKDSVLWNRPPQ
YMQSPSVPYRGIFLNDEDWGLMPWSTKNYDLTKRAGEIGIRTYSKIFELMMRLRANTLWP
AMHECTVPFHFVKGARETAEKYGIIIGTSHCEPMLRNSAGEWNDQLNGPYNFVTNSSNVI
HYWKERLLEVGQKENIYTVGMRGRHDGRMVER

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	36	329	9.3e-87	0.3787661406025825

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	4.42e-64	183	331	1	142	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam03648	Glyco_hydro_67N	0.001	45	150	22	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHV26130.1	3.00e-252	1	332	1	332
QAA39294.1	3.00e-252	1	332	1	332
QHV49213.1	3.00e-252	1	332	1	332
QTF04601.1	3.00e-252	1	332	1	332
QTF02290.1	3.00e-252	1	332	1	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	3.54e-85	38	328	21	301	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	1.47e-42	36	329	44	335	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
6NPS_A	1.45e-41	87	330	65	311	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
7PUG_A	9.23e-40	36	329	17	308	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.70e-39	36	323	16	301	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000686	0.998476	0.000357	0.000164	0.000149	0.000146

TMHMM  Annotations     

start	end
5	27