CAZyme Information: MGYG000002454_00123

Basic Information

• Species: Akkermansia muciniphila
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila
• CAZyme ID: MGYG000002454_00123
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		51826.39	7.5214

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002454	2762447	Isolate	China	Asia

• Gene Location: Start: 155089; End: 156510 Strand: +

Full Sequence      

MSIFSSRRQFLKSLGLAAGAAAAGNALPGKAVEIPAGDHLWESASPAAPRPSGSTYMGGF
KAPRLGRIRLAFIGVGGRGFSHLAQMCVMDGVEIVGICDLKEELTKRGVDRVLSRMGKSP
LGYSGGDMEYLTMLKELKPDAVIISTDWSSHARIACDSMKHGAHAFVEVPLAVSLEELWS
LVDTSEATRKHCMMMENVNYGRDELMFLNMVRQGVIGDLLHGEAAYIHCLVTQLGDTRGE
GAWRPEYHTRINGNLYPTHGLGPVAQYMNLERGEDRFCRVAAFASPALGRNAYAKKHLPA
DHRWNNTPFICGDMNTAVVKTQLGRTILVQLDETSPRPYSRANLIQGTEGTLAGFPTRVA
GEKLGNGNYHEWIEGREKLAAIYEKYDHPLWKRIGELATKMGGHGGMDFVMLSRIVECLR
NGEPMDQNVYEGASWSSLLPLTARSIAQGGMPVEFPDFTRGDWKTTMPLAVVS

Enzyme Prediction     

EC	3.2.1.49

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	65	465	1.4e-157	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	8.22e-18	66	228	2	157	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.60e-10	68	197	1	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHV21095.1	0.0	1	473	1	473
QTF06213.1	0.0	1	473	1	473
QAA61925.1	0.0	1	473	1	473
QAA66438.1	0.0	1	473	1	473
QAA64177.1	0.0	1	473	1	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	0.0	27	473	2	448	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	7.98e-76	67	464	20	432	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2UQL7	0.0	1	473	1	473	Glycosyl hydrolase family 109 protein 2 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0920 PE=1 SV=1
B2UL75	6.35e-231	5	472	5	480	Glycosyl hydrolase family 109 protein 1 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0017 PE=3 SV=1
A6WQ58	3.89e-166	7	472	6	457	Glycosyl hydrolase family 109 protein OS=Shewanella baltica (strain OS185) OX=402882 GN=Shew185_2813 PE=3 SV=1
A3D6B7	3.89e-166	7	472	6	457	Glycosyl hydrolase family 109 protein OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) OX=325240 GN=Sbal_2793 PE=3 SV=1
Q0HKG4	1.11e-165	7	472	6	457	Glycosyl hydrolase family 109 protein 1 OS=Shewanella sp. (strain MR-4) OX=60480 GN=Shewmr4_1375 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	0.000000	0.999981	0.000005	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002454_00123.