CAZyme Information: MGYG000002453_01732

Basic Information

• Species: Akkermansia muciniphila_B
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_B
• CAZyme ID: MGYG000002453_01732
• CAZy Family: GT10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		40174.1	7.7159

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002453	3096868	Isolate	China	Asia

• Gene Location: Start: 92726; End: 93757 Strand: -

Full Sequence      

MKVKIGFMEGAEEWQIKVFLYRFRNIDPSILEFEIDKNNADFLIAFPWLYRSTKETFLQF
LQESVGKITIMDVLGEAIAPNLNLFDYHIGFDPSGQDGRVLEAPYIFSYRVLLDSLSPEN
LSGVLAGKSGFCNYIYSHGEGHPYRIQLFSRLSAYKKVNAIGKHLNNTPCNFPRESDDWM
KGSVLLKEPYKFSISCENAWYRGYSTEKIITSFQARSIPVYWGNPLIEEEYNPKAFINCH
RFSSLDEVVAEIRRIDEDDELWRSMVAEPKCLPWQIERTQEKEDKMMAALLEIFTSPVEQ
VKKRGDGLWLDHYRNFFIRHLGSRKKTPKEKLEIRLKKLFRRS

Enzyme Prediction     

No EC number prediction in MGYG000002453_01732.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	116	281	4.5e-38	0.4610951008645533

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00852	Glyco_transf_10	3.74e-11	137	264	10	132	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP48815.1	5.28e-200	1	343	1	347
QWP73337.1	1.76e-198	1	343	1	347
QUY58235.1	2.83e-198	1	343	14	360
QHV61912.1	2.83e-198	1	343	14	360
QHV74279.1	2.83e-198	1	343	14	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	1.66e-20	75	268	94	310	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	1.15e-19	75	268	94	310	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5UQ63	1.29e-23	81	269	378	566	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
O30511	1.86e-19	75	268	94	310	Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
Q6P4F1	7.30e-08	80	266	162	351	Alpha-(1,3)-fucosyltransferase 10 OS=Homo sapiens OX=9606 GN=FUT10 PE=1 SV=2
Q6NTZ6	3.01e-07	80	266	152	341	Alpha-(1,3)-fucosyltransferase 10 OS=Xenopus laevis OX=8355 GN=fut10 PE=2 SV=2
Q6A1G3	3.02e-07	134	266	208	343	Alpha-(1,3)-fucosyltransferase 10 OS=Xenopus tropicalis OX=8364 GN=fut10 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002453_01732.