CAZyme Information: MGYG000002452_01018

Basic Information

• Species: Akkermansia muciniphila_C
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_C
• CAZyme ID: MGYG000002452_01018
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
716		79446.81	6.0255

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002452	2902150	Isolate	China	Asia

• Gene Location: Start: 1259959; End: 1262109 Strand: -

Full Sequence      

MDQDRILYRGEAFTLTGNSVRQDAAHWVEVQPDGQVKTMKNGRYSEWRILPEAGNAPHYR
GSFEVLNKAYSLALNEASSLLNGEGTFRTGANWPTVWTRDISYATHLGLGLWNVHACMKS
LNARVRNGEVEQDTGTGGSWPISSDRVVWGMAAWEVYCLTGDAGWLSRSCRVLEKTCRRD
EEVLAATGGLMKGESSFLDWREQSYPAWMTSADIGDSCSLSTMVLHVEARRGLARMFREL
GREEKAREWEEKSAGLSAVIERFFRIPEHALYGQYLYGRGYPVLSEKVDSLGNLLCVLLG
QAHGSHAAGMVAVLPHCVYGIPCFHPQMPDGVPPYHNRAMWPFLEGYYAQAAAAVENEAA
LSLAFACMVRAALLCGTNKENILLETGLDEGLLLSSDSQLWSIAGMLGSFYKGLFGIRLL
PDSLEFRPCVPASFEGVHELSGLEYRGMTVDVRLRGSGHRVARCLVNGREGRPALSADMK
GRVLVELELVPGEEGEGRVNLAHMGGSLAAPEWKAGRHGIAWEAVNGADYYRVYRNGIPV
SQTEHCHYMPSPSRGDVYFQVMAVALDGRESYLNEPNDYPSADSRMETRPCGLSGDEVWF
SRVTESPDALCYNVNIDRPGVYRVDAFFANGTYDVSDGNTCALRSLYLNGRRAGTLAFPH
TSRSGNWEYFIYSTAVEVVMTPGPCRVEVVYDAFSENMNRLVNDMVIKHLRFTRIS

Enzyme Prediction     

No EC number prediction in MGYG000002452_01018.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	1.60e-05	184	469	747	1031	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
cd04083	CBM35_Lmo2446-like	3.67e-05	608	693	37	112	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
COG3408	GDB1	0.004	149	348	344	544	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
cd04079	CBM6_agarase-like	0.009	608	683	43	109	Carbohydrate Binding Module 6 (CBM6); appended mainly to glycoside hydrolase (GH) family 16 alpha- and beta agarases. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family 16 agarases. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the activity of alpha- and beta-agarase catalytic modules which are involved in the hydrolysis of 1,4-beta-D-galactosidic linkages. These CBM6s bind specifically to the non-reducing end of agarose chains, recognizing only the first repeat of the disaccharide, and directing the appended catalytic modules to areas of the plant cell wall attacked by beta-agarases. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. This family includes three tandem CBM6s from the Saccharophagus degradans agarase Aga86E, and three tandem CBM6s from Vibrio sp. strain PO-303 AgaA; in both these proteins these are appended to a GH16 domain. Vibrio AgaA also contains a Big-2-like protein-protein interaction domain. This family also includes two tandem CBM6s from an endo-type beta-agarase from a deep-sea Microbulbifer-like isolate, which are appended to a GH16 domain, and two of three CBM6s of Alteromonas agarilytica AgaA alpha-agarase, which are appended to a GH96 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMQ00027.1	2.88e-133	45	716	198	876
AHM62083.1	4.01e-132	47	715	223	900
AMR26804.1	4.88e-132	46	716	227	907
QMU30083.1	4.86e-131	45	716	209	890
QJX46424.1	2.19e-130	45	716	229	911

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002452_01018.