CAZyme Information: MGYG000002452_00706

Basic Information

• Species: Akkermansia muciniphila_C
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_C
• CAZyme ID: MGYG000002452_00706
• CAZy Family: GT11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233		26791.84	7.2667

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002452	2902150	Isolate	China	Asia

• Gene Location: Start: 870916; End: 871617 Strand: -

Full Sequence      

MFTLAAACAHALRVGVPCHVPWNYNDATLLLRSRLGDWVLPSTPCGVNEPAAWQEPSFAY
HPIPLHITRGGVCGYFQSARYFEGQEPFIRSLFAPFIAEKEPRTAGIHIRLGDYKQLRHK
HRVHGIDFLQRAFTHISPDVNRLILFSDEPEAAADMLVHLPEFRRLPLEIDCNNTCEALR
RMTAMEELIISCSSFSWWGAWLGQTRKVIVPRHWFSGVIEDYQDVYLPHWVKL

Enzyme Prediction     

No EC number prediction in MGYG000002452_00706.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	74	233	2.8e-32	0.6268115942028986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	2.69e-25	1	215	15	256	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	2.61e-09	51	231	106	295	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP42828.1	2.89e-125	1	233	20	252
QWP64754.1	2.89e-125	1	233	20	252
QWO82663.1	2.89e-125	1	233	20	252
QUF76929.1	2.89e-125	1	233	20	252
QWO87465.1	2.89e-125	1	233	20	252

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	1.30e-11	68	233	116	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.774856	0.223881	0.000357	0.000481	0.000214	0.000226

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002452_00706.