CAZyme Information: MGYG000002449_02197

Basic Information

• Species: Parabacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides acidifaciens
• CAZyme ID: MGYG000002449_02197
• CAZy Family: PL35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609	MGYG000002449_23|CGC1	68457.9	6.4511

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002449	5100482	Isolate	not provided	not provided

• Gene Location: Start: 31385; End: 33214 Strand: +

Full Sequence      

MNKTLFLLATCLLLCLGMHSVAQTFDYSRVESHPRLLMKQGEEQDIRKSLEGNPEMQRVY
NQIVGEADRLMIKPTLTYKKEGRRLLAVSREALKRIFDLSFVYRMTGEDKYRLRAEQEIV
SVCSFDDWNPSHFLDVGEMTMAVAIGYDWLYDRLSPETKKLAREAILQKGFAPSNDEQYN
WFLKAENNWNQVCNTGLVYGALALLESDSKVATGIIERAMSSVPLSMKVYAPDGNYPEGY
NYWGYGTSFNAMLIAALESALGSDGGLCATEGFMPSARFMQYMAGTTGLAFNFSDARETT
QSFPAMFWYASKLNDPSLLWNEKIFLTRGDTHFTAEEERFLPIILIYGSHFNMEEVTPPV
SKIWVGHGKVPVALIRTGWNEGEGFYVGIKGGTASANHAHMDAGSFVFEALGVRWAQDLG
MQEYYSLEKENVRLWNSNQDGQRWDVFRYNNFVHNTLTVNGEKHQVKGTVPILATYTKDA
KLGASLDMTSLFGDDLKKATREVALIKEQYLQVTDRVQAAGKPASVRWTMVTSATPKQID
AHTMELTKEGKKLHLVLDSPSSASFSVIDNVPSHSYDAPNPGSVRIIFDADLKAGQKETL
KVRFVPVTR

Enzyme Prediction     

No EC number prediction in MGYG000002449_02197.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL35	383	561	1.1e-64	0.9832402234636871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07940	Hepar_II_III	7.73e-10	387	598	28	231	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
pfam16332	DUF4962	1.69e-07	32	170	136	290	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT49750.1	0.0	1	607	1	607
AYB29714.1	1.83e-263	22	606	18	600
QIU93528.1	1.89e-214	1	607	1	603
QUR45369.1	2.17e-213	21	607	19	603
QGT72630.1	8.77e-213	1	607	1	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2FUQ_A	7.46e-06	31	406	21	389	ChainA, heparinase II protein [Pedobacter heparinus],2FUQ_B Chain B, heparinase II protein [Pedobacter heparinus]
3E80_A	7.47e-06	31	406	23	391	Structureof Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_B Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_C Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000271	0.998910	0.000328	0.000154	0.000151	0.000147

TMHMM  Annotations     

start	end
5	27