CAZyme Information: MGYG000002449_00776

Basic Information

• Species: Parabacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides acidifaciens
• CAZyme ID: MGYG000002449_00776
• CAZy Family: GT23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		37103	9.3233

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002449	5100482	Isolate	not provided	not provided

• Gene Location: Start: 139477; End: 140415 Strand: +

Full Sequence      

MNVEEYQKINKSFKRKLIYKVGLDCGFFSEYNNMILAMAYCITHKIQFILSSNNANFDYE
NGWCGFFEPFCEDIVSEKEQHYKTVNWKYMLKLLLRQKEFKILRNIFPYFSFYKKQMYTQ
DIFGRSRDYGLLKKRIKVKSLKSKLSFQELCSILVNLTWKYNSEVKKEVHELISSLGLPA
EYVGFHIRGGDKFLEYQIEPIESYFAKNKTGIKNIFVLTDDFTIISEIKRKYPDHIVYTL
CEESEHGYFHGDFMNQDEKYRRRKLIRLFASIDICATSKLFVGTFSSNPGMYLGMRSPSI
SQGIDFNKWIIW

Enzyme Prediction     

No EC number prediction in MGYG000002449_00776.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT23	14	288	3.7e-21	0.8364779874213837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11300	Fut8_like	4.81e-13	160	288	164	299	Alpha 1-6-fucosyltransferase. Alpha 1,6-fucosyltransferase (Fut8) transfers a fucose moiety from GDP-fucose to the reducing terminal N-acetylglucosamine of the core structure of Asn-linked oligosaccharides, in a process termed core fucosylation. Core fucosylation is essential for the function of growth factor receptors. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11296	O-FucT_like	8.48e-06	145	288	34	192	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCY57900.1	6.08e-109	1	312	1	311
QUT51863.1	6.08e-109	1	312	1	311
BCI62108.1	6.93e-74	3	312	2	310
SDS80372.1	7.14e-74	4	312	8	311
ADQ79466.1	1.22e-68	1	296	1	322

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999835	0.000165	0.000002	0.000001	0.000001	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002449_00776.