CAZyme Information: MGYG000002443_00019

Basic Information

• Species: Helicobacter_B sp001854545
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_B; Helicobacter_B sp001854545
• CAZyme ID: MGYG000002443_00019
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		45817.96	8.7414

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002443	2255545	Isolate	not provided	not provided

• Gene Location: Start: 23502; End: 24797 Strand: +

Full Sequence      

MIVITGGGTGGHLSIAQSLGEELRKRGKKAVYIGSLSGQDRAWFGDAGADSRAEFSLDSV
DSDAGVKSGAESSAQNSTNAGSTNAESTNADSADTNSTALFEACYFLPTSGVVNKRGLSK
LASIFAQLSALQKVREIFKRHKVRAVISVGGFSAGPASIGAIVFRKPLFIHEQNATMGRL
NELLAPFAKRVFSAFKEPFTPYPIKQEALQKRRIRNKLESIIFIGGSQGAKAINDVALAL
APTLLSRGISITHQCGARDLARVREAYQKLGLLDKITLFDFSKELISYLVRADVCVARAG
ASSVWENAALAIPTLYIPYPHAAKNHQASNAQFFVSRGAGAMILERDLQSSLQGDLQKDL
SADSGALESSKMDSADSAKLDSTKNPVLDFIDSCTPSMLESTSQALASMININGASVIID
EVLSYLGASQN

Enzyme Prediction     

No EC number prediction in MGYG000002443_00019.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	221	373	3.7e-40	0.9299363057324841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	4.80e-91	12	394	14	354	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	5.84e-76	12	384	12	345	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	1.46e-74	12	385	13	343	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	2.45e-68	105	348	54	309	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	1.93e-31	221	380	2	165	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAM31450.1	2.46e-102	1	422	1	342
BAM11520.1	2.46e-102	1	422	1	342
QOQ90380.1	2.46e-102	1	422	1	342
BBB19037.1	2.46e-102	1	422	1	342
QOQ96549.1	3.48e-102	1	422	1	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	2.58e-28	115	346	72	307	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	3.54e-28	105	339	62	312	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	5.10e-23	106	348	60	310	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7U322	2.70e-102	1	348	1	302	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) OX=235279 GN=murG PE=3 SV=1
Q17WB5	4.08e-88	2	348	3	304	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter acinonychis (strain Sheeba) OX=382638 GN=murG PE=3 SV=1
A0RP87	1.31e-87	1	423	1	333	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Campylobacter fetus subsp. fetus (strain 82-40) OX=360106 GN=murG PE=3 SV=1
B5Z8F1	3.23e-84	4	348	5	304	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain G27) OX=563041 GN=murG PE=3 SV=1
Q9ZK59	6.44e-84	4	348	5	304	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Helicobacter pylori (strain J99 / ATCC 700824) OX=85963 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002443_00019.