CAZyme Information: MGYG000002438_01749

Basic Information

• Species: Parabacteroides distasonis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides distasonis
• CAZyme ID: MGYG000002438_01749
• CAZy Family: GT10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	MGYG000002438_1|CGC31	38986.74	6.9286

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002438	5030699	Isolate	South Korea	Asia

• Gene Location: Start: 2082555; End: 2083550 Strand: +

Full Sequence      

MVKELNINIISPIAELFEKQLSLDWESRGVRFFFNSKEERLWDAIVVYENISEPYTLRCR
KGGLFFISGEPPIVKVYSQAFISLFDHVISAHNLKHPNNHRDQQALPWYFGYNFQTASPS
YAYEEIEKMEVPEKKRKISFITSSRTFLPGHTRRLAWMRKIRELYGDEIDFYGKGICSVD
DKAKALASYEFSICIENSYEYDYWTEKIADAILAYTVPIYCGCKNIDAYFPSEAMISLNI
NDEQGSIALINNVLNDSKRIYQEKLPFLKEARNRLLFKYNLFPFVKSYIDKYVDLDCDEY
RSVLIKPYDTYPKDWIQDVLLKTKRVVCKIF

Enzyme Prediction     

No EC number prediction in MGYG000002438_01749.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	106	248	1.9e-28	0.4265129682997118

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00852	Glyco_transf_10	0.005	168	236	30	105	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO15364.1	2.19e-249	1	331	1	331
ABR44498.1	2.19e-249	1	331	1	331
QUT21271.1	4.24e-247	1	331	1	331
ACM19832.1	1.66e-50	27	307	22	310
QFS96710.1	4.88e-46	29	282	28	281

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	4.19e-07	178	265	221	308	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	4.62e-07	178	265	221	308	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LJK1	6.76e-07	168	271	239	346	Glycoprotein 3-alpha-L-fucosyltransferase A OS=Arabidopsis thaliana OX=3702 GN=FUT11 PE=1 SV=1
O30511	2.75e-06	178	265	221	308	Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002438_01749.