CAZyme Information: MGYG000002437_01862

Basic Information

• Species: Blautia hominis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia hominis
• CAZyme ID: MGYG000002437_01862
• CAZy Family: GH1
• CAZyme Description: 1,4-beta-D-glucan glucohydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	MGYG000002437_2|CGC7	49368.47	5.1616

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002437	5878941	Isolate	South Korea	Asia

• Gene Location: Start: 751470; End: 752759 Strand: +

Full Sequence      

MKQLFPEFLLGAATAAHQVEGNNIHSDFWAMEQMKYSSFNEPSLDAVDHYNRYREDIDLL
AEAGLNAYRFSIEWARIEPKQGVYDLKEVEHYKDVITYCKSKGVEPIVTMHHFSSPKWLI
EEGGWENEKTIEAFAKYCTCVIQEIGDMLTYICTINEANMGLELAAIMRSYMKQVQQDAK
NANSDIQVGVKLEMPDDMQEKMADMSQVFGGIDPTKVHTFLSMRTEAGDRLIMRAHETAR
NAMKRLYPHLKIGVTLSLHDLQVQPGGEVNAAKEWEEEFRHYLPYIKNDDFFGLQNYTRK
LVGPEGALPVPEGMEKTQMGYEFYPQALANLIRRVNKELDIPIIITENGVAVDDDKRRET
FIKEALTGVMDCIAEGIPVCGYMYWSLLDNFEWQMGYKKTFGLIEVDRKTQKRVPKNSLK
FLGDFKLNR

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	425	2e-112	0.972027972027972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03356	BGL	1.43e-89	8	421	4	425	beta-galactosidase.
COG2723	BglB	2.49e-86	5	418	4	442	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	2.90e-75	1	425	1	447	Glycosyl hydrolase family 1.
PLN02814	PLN02814	1.22e-34	5	425	28	479	beta-glucosidase
PLN02998	PLN02998	1.36e-32	6	425	33	484	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ16638.1	6.36e-194	7	428	2	419
AEN97245.1	1.09e-181	8	425	7	432
AJG98209.1	3.26e-178	1	426	1	429
AIQ31520.1	9.97e-178	8	423	9	415
AXB29242.1	7.58e-177	1	425	1	430

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4R27_A	6.68e-124	1	425	3	408	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
6IER_A	5.18e-92	8	423	36	425	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
6Z1H_A	1.99e-70	5	418	11	437	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
1VFF_A	4.61e-54	5	424	5	401	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
7E5J_A	2.95e-53	7	424	9	439	ChainA, Beta-glucosidase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10482	2.84e-51	1	425	1	450	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
Q08638	1.32e-48	5	418	6	431	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
P12614	6.46e-48	5	421	11	441	Beta-glucosidase OS=Agrobacterium sp. (strain ATCC 21400) OX=74562 GN=abg PE=3 SV=1
B9K7M5	1.86e-45	5	418	4	429	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
P0C946	1.29e-44	5	414	4	425	1,4-beta-D-glucan glucohydrolase (Fragment) OS=Thermotoga neapolitana OX=2337 GN=bglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.951243	0.048548	0.000106	0.000061	0.000037	0.000053

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002437_01862.