CAZyme Information: MGYG000002436_03481

Basic Information

• Species: Pigmentiphaga sp002188635
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Pigmentiphaga; Pigmentiphaga sp002188635
• CAZyme ID: MGYG000002436_03481
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
767		86325.44	9.0025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002436	5862145	Isolate	Canada	North America

• Gene Location: Start: 11401; End: 13704 Strand: +

Full Sequence      

MSAAIDEDALRAGEADAQERTLLEAYGPELDEYGVVRRDEAGRVCIQTAPAIKRSSMVPE
PWVTNPFVRGWRRVQGRMHKTRAERLARPPEPRWKIAGRLRRLTLLVAVVAQTAVATWYM
KAVLPYQGGQILEVAILLLFALLFCWVSAGFWTALMGFLQLLMGRDRYSISATVAEGVPI
SAGTRTALVMPICNEDVGRVFAGLRATYESVARAGVLDKFDFFILSDSYKPDNCVQEQRA
WVELCKTVEGFGRIHYRRRRRRVKRKSGNIDDFCRRWGGEYDYMVVLDADSVMSGECLKR
LVVLMDANPEAGIIQSAPRASGMDSLYARVQQFATRVYGPLFTAGLHFWQLGESHYWGHN
AIIRLEPFIQHCALAPLPGKGSFAGAILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPP
NLLDELQRDQRWCQGNLMNFRLFLIKGLHPVHRAVFLTGVMSYLSAPLWFLFLALSTALL
AVHTLTEPQYFVTPHQLFPIWPQWHPEEAIALFSTTAVLLFLPKILSVLLVWVKGAQGYA
GSGKLLWSMLLEVLFSMLLAPIRMLFHTRFVVAAFLGWKVQWKSPARANNETPWREAFRR
HGLQTLLGVCWGLLVAWLNPNFLWWMIPILASLLLAIPLSVMSSRVSLGKGAFEDGLFCI
PEETSPPRELHDTARYNEENQARPAPGFMDALTDPAANALARAFATGRHLPGHPLIEAAR
ARLVDEVLEKHPEHLPDPTRMRLLDDPEVLARVHRALARPAAQVRAA

Enzyme Prediction     

No EC number prediction in MGYG000002436_03481.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	188	369	3.4e-24	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2943	MdoH	0.0	22	757	1	719	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
PRK05454	PRK05454	0.0	40	658	1	599	glucans biosynthesis glucosyltransferase MdoH.
cd04191	Glucan_BSP_MdoH	9.17e-148	186	439	1	254	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
pfam00535	Glycos_transf_2	7.89e-13	189	368	3	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam13632	Glyco_trans_2_3	3.34e-11	283	482	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZG10328.1	0.0	1	767	8	774
QEI09382.1	0.0	15	754	59	797
ARP88138.1	0.0	22	757	73	810
ARP92100.1	0.0	22	757	73	810
ANN79775.1	0.0	44	757	94	809

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48PK6	0.0	1	754	41	818	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=opgH PE=3 SV=1
Q6D6A7	0.0	25	754	74	827	Glucans biosynthesis glucosyltransferase H OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=mdoH PE=3 SV=1
Q4ZZH4	0.0	1	754	41	818	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=opgH PE=3 SV=1
Q4KJM5	0.0	12	754	52	816	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=opgH PE=3 SV=1
Q87UY1	0.0	1	754	41	817	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000008	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
103	120
135	157
463	485
510	532
545	567
622	644