CAZyme Information: MGYG000002436_01561

Basic Information

• Species: Pigmentiphaga sp002188635
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Pigmentiphaga; Pigmentiphaga sp002188635
• CAZyme ID: MGYG000002436_01561
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		32266.5	6.8763

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002436	5862145	Isolate	Canada	North America

• Gene Location: Start: 347374; End: 348312 Strand: -

Full Sequence      

MPDAQSSSSTEQPDPRPRPGVTDWCRSINSYVGLAVLAMAAVVWSVPGLRDQASQFTAFN
GVDAPVAEPAQVDVASAVAAAAAVAAVADNVQPHAQATSFLGSVTSNAVKPAPKPHATKV
SAVQAESLGRYIARKYRVSNEATRMLISTAYGVGQEMGLDPLLLLAIIAIESSFNPFAES
HVGAQGLMQVLTRVHTERFEPFGGSQAAWNPVANIRVGASILKEYIERGGSLTAGLRMYV
GVGPDGTSPYGDRVLAERRRLASAAGVNADLPGAAPATPARSASAKPMPIPTDPSSEAVS
VKNAEPGSPAVM

Enzyme Prediction     

No EC number prediction in MGYG000002436_01561.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	160	260	2.3e-17	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.48e-15	155	239	13	102	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	2.47e-14	161	239	1	78	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	9.61e-14	158	230	9	82	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13400	LT_IagB-like	2.06e-13	158	260	2	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16893	LT_MltC_MltE	1.98e-12	158	223	11	86	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZG10317.1	1.08e-197	1	312	34	344
QEI09125.1	5.24e-62	1	272	11	274
QGC90650.1	1.06e-58	1	267	1	271
QGB17852.1	1.06e-58	1	267	1	271
QBS68318.1	1.06e-58	1	267	1	271

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27380	1.78e-06	156	241	17	97	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999232	0.000423	0.000017	0.000002	0.000001	0.000353

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002436_01561.