CAZyme Information: MGYG000002434_00520

Basic Information

• Species: Campylobacter_A concisus_G
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A concisus_G
• CAZyme ID: MGYG000002434_00520
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297		34491.76	7.1712

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002434	1924634	Isolate	Denmark	Europe

• Gene Location: Start: 44; End: 937 Strand: +

Full Sequence      

MDKFINSFNESKSLTRVDSGMWEDGDEGINVLIEIKDYPFTLDMLKQVFTNIKTNQEYIL
QEMVDELNRRDDGDGIQMYVKYKLNTRNRLEHFFGQCAVEVESSFPKLTESLDYSVEGLV
RSNIGYFKNNYDRSKDVGRIKDTKGKIIQKADQEAIANRGYADENRPKDLRLGNTEEGDG
WKYRGRGIIQITGREIYTEFNKFAHKVKLVGDEVSFVDNPELVAENKTYAFVSAAFFWAQ
KKNIYDRADKSKPELDNEEIVNRVTDLVNGGANKESRTKRINSYKRIREANIFKKFK

Enzyme Prediction     

No EC number prediction in MGYG000002434_00520.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	83	288	6.6e-28	0.7142857142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	4.15e-26	81	288	33	201	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	2.92e-09	182	294	102	215	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	4.17e-04	180	286	104	217	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPI03469.1	1.00e-195	1	297	890	1186
QPH88520.1	1.00e-195	1	297	890	1186
QPI07229.1	8.11e-172	1	297	909	1206
QPH85036.1	1.84e-85	1	296	889	1182
AVX44620.1	1.07e-83	1	296	916	1210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	1.21e-14	105	273	68	206	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	1.16e-13	93	273	43	182	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O64203	1.60e-06	172	282	250	355	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002434_00520.