CAZyme Information: MGYG000002432_01927

Basic Information

• Species: Campylobacter_A concisus_F
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A concisus_F
• CAZyme ID: MGYG000002432_01927
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000002432_84|CGC1	38554.82	9.7709

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002432	2010217	Isolate	Denmark	Europe

• Gene Location: Start: 2310; End: 3365 Strand: +

Full Sequence      

MRAFKFILFVAIFALGLNGAEVSLRAKVSQMIMVGFNGASTKDAAFRAMLSDAGYERFGG
VMLLGRNVTSKAQLKASIKAIKEKSPKIFIAIDEEGGNVSRMKDKSFDGPYPSAYEVAST
LDIKSAYDLYSKMAINLKECGINLNFAPVVDLHDENSPIIAAKQRAFSEYASKVVIYADA
FMDAFKEQGILTTLKHFPGHGSSKEDSHKNKSEVTLSKDVLLPYKDAISTGRAQIIMVGH
LFVKGIDEDNPATLSKKIITDLLRNELKFNGVVISDDMLMKGVGGEALAQKVVKFINAGG
DILLFSEFKINNQRTADLVTQIIMDAVNEKKISKERIDASYKRIMALKTKL

Enzyme Prediction     

No EC number prediction in MGYG000002432_01927.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	87	304	6.7e-49	0.9490740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.70e-70	22	351	1	315	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.94e-61	23	347	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	8.19e-51	59	343	27	308	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.16e-08	141	276	150	287	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVX43932.1	3.07e-241	1	351	1	351
EAT97513.1	3.07e-241	1	351	1	351
QPI06839.1	4.36e-241	1	351	1	351
QPI04948.1	6.19e-241	1	351	1	351
QPH97751.1	6.19e-241	1	351	1	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	6.42e-45	18	348	7	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	4.37e-36	21	350	41	395	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.78e-35	21	350	15	369	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.15e-35	21	350	45	399	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3TEV_A	2.12e-31	59	346	45	333	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KXK3	6.36e-38	55	304	23	278	Beta-hexosaminidase OS=Shewanella sp. (strain ANA-3) OX=94122 GN=nagZ PE=3 SV=1
Q0HJG7	6.57e-37	55	304	23	278	Beta-hexosaminidase OS=Shewanella sp. (strain MR-4) OX=60480 GN=nagZ PE=3 SV=1
Q8EEW2	1.78e-36	55	304	23	278	Beta-hexosaminidase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=nagZ PE=3 SV=1
Q0HVQ8	9.41e-36	55	304	23	278	Beta-hexosaminidase OS=Shewanella sp. (strain MR-7) OX=60481 GN=nagZ PE=3 SV=1
C4LEY6	1.55e-35	59	304	27	275	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000386	0.998916	0.000206	0.000148	0.000168	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002432_01927.