CAZyme Information: MGYG000002422_01625

Basic Information

• Species: Campylobacter_D jejuni
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_D; Campylobacter_D jejuni
• CAZyme ID: MGYG000002422_01625
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689	MGYG000002422_6|CGC1	79851.22	9.6278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002422	1714563	Isolate	United Kingdom	Europe

• Gene Location: Start: 7631; End: 9700 Strand: +

Full Sequence      

MKHYSISKKLIANVRNFYTISLYKKNSKINKDDLFLGWGRKKSGLKAINLAKKYKAKFIL
LEDGFIRSLNLGVENSPSFSMVKDDIGIYYDATAPSKLENLLNTYEFKDEEIKQAKKAIE
LIKKYKISKYNNNLDIPDDYFQKDEKRVLIITQTANDASLEFGLAKGFKTVDMIKDAIKE
NPKSKIYIKIHPDVLSGKKQSDLDINSLPKECILITENFNPVALLEFFDKVYTKTSGMGF
EALMQECECICYGMPFYAGWGLTKDKLECKRRMQKRSLEEVFYVAYILYAEYFNPYLNQK
SNIFDTIQTLAKYKDIEKANSNRLFFFGFSKWKRKFVKPFFIAKNNEIIFLDFLDCLKNI
QLKENDKFFIWGKRIDYNALKTTLIKKAQDENLLHFTPKISLVEDGFIRSISLGSDLTRP
FSLIVDDKGLYIDPNKASKLEELLQNEIFDENMLNRAKNIIKILLENRFSKYNGLKHEDL
KINAKIGQKIILIPAQVEDDASMILGGFGLSTLDLLKEVRAKNQDAYIIFKPHPDVLSGN
RVGLKDETLILEFCDEIVKDCSIDSAIKIADEIHTITSTSGFDALLRAKKVFTYGMPFYA
GWGLTKDKYRCERRTRKLSLEELVAGALIAYPRYINPKTKTLCEIEVCLDIMLNLQKAYF
SKKYIKLAIDFKTFMLRKIRRFYEFLAKK

Enzyme Prediction     

No EC number prediction in MGYG000002422_01625.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	289	660	1.6e-128	0.6766917293233082
GT107	24	311	6.5e-102	0.5375939849624061

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	1	687	1	671	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16439	beta_Kdo_transferase_KpsC_2	6.35e-134	366	634	1	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16440	beta_Kdo_transferase_KpsC_1	1.37e-133	35	295	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16439	beta_Kdo_transferase_KpsC_2	1.46e-88	35	292	3	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	2.98e-81	370	634	3	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATG65574.1	0.0	1	689	1	689
AZR09300.1	0.0	1	689	1	689
QGG37339.1	0.0	1	689	1	689
QJE66093.1	0.0	1	689	1	689
QFZ66531.1	0.0	1	689	1	689

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGB_A	1.70e-76	37	310	48	321	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGD_A	2.44e-63	327	657	7	323	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]
6MGC_A	5.57e-55	38	340	43	348	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P57037	1.43e-145	36	657	57	679	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
Q05013	4.02e-145	36	657	57	679	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P42217	1.31e-127	33	654	37	643	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
P31858	1.22e-48	403	646	147	393	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002422_01625.