CAZyme Information: MGYG000002418_00505

Basic Information

• Species: Parabacteroides chinchillae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides chinchillae
• CAZyme ID: MGYG000002418_00505
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854	MGYG000002418_1|CGC10	96999.99	6.6848

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002418	3822361	Isolate	not provided	not provided

• Gene Location: Start: 576026; End: 578590 Strand: +

Full Sequence      

MLLCATVLSVQAQKSMDEIDRESFNAQYKPFQKAGISVTLKPQAIIHSQPTKDLMLNGNW
QLAKGGNEKERLGGNWSDAITASVPGSVHGSLWKAGIIPDPYLRQNDSIATRQSYEAAWW
YKKEFSITDKLNAPRLIFDGIANKCTVWLNGVKLGNHEGMFGGPFFDVNKLLKEKNTLIV
KLEPIPRIFEENDSTLSNTSWRNTVVFNCVYGWHYSRIPSLGIWRPVYIKNHASVEIEHP
FIATRSLDGDMSLQLTLRSASDKPKGTLKVSVLPDNFEGEETSFDYKIASSRKEETVCFD
FKIKNPRLWWPNGKGDPNLYKLKISFVPDNQGTADYAETSFGIRTIKMAPSPEGVSPDRY
NWTFVINDKPMFVKGTGWCTMDQLMDFPREKYDHLLSIAKQQNIQMLRAWGGGIPETDDF
YDLCNRYGIMIIQEWPTAWDSHLTQPYNVLKETVELNTLRIRNNPCLVMYGGGNESPAPF
GEAIDMIGRTSIELDGTRPFHRGEPWGGSTHNYYCWWERAHLNHALNMTSPFWGEFGIAS
LPQKESVMKYLSDSEKNVWPLGQKSDFVHHTPIFGIASDLQRLAQYSGYLMPDNTIDHFI
TGSQLAQVVAVRHTLERARTRWPESSGALYYKLNDNYPAASWAAVDWFGAIKPIHYFVQN
SFAPLASVILFNQTNMSSQAVSLPVFLLDDNLDLKGKSWEINISCYNHTLALIKQESFQG
KDNQKEVNQLGSLNLDTDQTRSPALLFVSEVRSEDKLLFRTFYFMNFEVQKGSLFNLPRT
TLATERSGNRITITNTGKLPAVGVNIQCPENEYRLIVSENFFWLNPGESKTVDVNLSKEI
KTDCWNLEGNPFIN

Enzyme Prediction     

No EC number prediction in MGYG000002418_00505.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	48	683	3e-85	0.636968085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.10e-44	56	699	15	672	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.13e-16	121	501	113	473	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	1.68e-16	56	499	15	444	beta-D-glucuronidase; Provisional
pfam00703	Glyco_hydro_2	4.90e-13	235	344	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02836	Glyco_hydro_2_C	4.03e-09	364	501	8	159	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL39861.1	0.0	2	848	11	853
SCV07058.1	0.0	2	848	11	853
QRQ54566.1	0.0	2	848	11	853
ALJ47660.1	0.0	2	848	11	853
QRM99695.1	0.0	2	848	11	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.51e-68	47	764	20	745	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	6.00e-59	54	832	9	814	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	6.12e-59	54	832	11	816	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	6.19e-59	54	832	11	816	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.51e-58	54	832	9	814	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4FZV0	4.04e-49	56	668	25	694	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
Q95327	3.10e-48	54	668	23	694	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q8K2I4	4.15e-48	56	668	25	694	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1
O00462	3.20e-47	56	682	25	708	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3
Q29444	7.67e-47	54	668	23	694	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004650	0.994235	0.000285	0.000339	0.000244	0.000222

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002418_00505.