CAZyme Information: MGYG000002416_00399

Basic Information

• Species: Hydrogeniiclostridium mannosilyticum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Hydrogeniiclostridium; Hydrogeniiclostridium mannosilyticum
• CAZyme ID: MGYG000002416_00399
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		43534.31	5.5443

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002416	3014016	Isolate	Russia	Europe

• Gene Location: Start: 425050; End: 426198 Strand: +

Full Sequence      

MIKVGIAGARGLSNLLGLRAIPDVEVSAICDLDEDVLNQMAEEHHIPNRFRVFDDMLETD
IDAVIISTPMQCHVPQAIAALEAGKHVFSEVTAGVTMDELWWLIENVEASGKVYMYAENY
CYTPYNQLIRAMVQKGMFGTPYYAEGEYLHDVKSMTTYHYDIHQSGKTSWRKYWQLGKHG
AFYPTHSIGPVMQWFEGERISSISTFTSGRHVAMDLRQEDTTITMCQMASGKLARIRVDC
ISPRPHNMTFYQLQGTKGVVETPRGLGDVCKVWLEDYNHDENKDDRQWRPLSDFNSLLPE
RYKNATEEQKKAGHEGGDFFIVEDFINAIRYGTKPAIDVYQACEWTAVGLLSELSVTNGG
RAIDIPHFRKNMPYEEQHISLR

Enzyme Prediction     

No EC number prediction in MGYG000002416_00399.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	370	1.5e-97	0.9699248120300752

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	7.53e-35	1	366	3	341	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	9.90e-13	2	115	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	1.61e-05	53	113	60	117	putative oxidoreductase; Provisional
smart00859	Semialdhyde_dh	3.45e-04	3	89	1	97	Semialdehyde dehydrogenase, NAD binding domain. The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase, an enzyme involved in the biosynthesis of various amino acids from aspartate. This family is also found in yeast and fungal Arg5,6 protein, which is cleaved into the enzymes N-acety-gamma-glutamyl-phosphate reductase and acetylglutamate kinase. These are also involved in arginine biosynthesis. All proteins in this entry contain a NAD binding region of semialdehyde dehydrogenase.
smart00881	CoA_binding	0.009	4	84	11	89	CoA binding domain. This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHW35532.1	3.92e-183	2	381	3	381
QHW33651.1	4.46e-180	2	381	3	382
QHT62446.1	7.35e-179	2	381	3	382
BBH24596.1	1.62e-175	2	381	3	381
AEE96970.1	9.97e-175	1	381	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	4.23e-37	8	368	29	426	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	7.58e-32	8	370	51	435	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3MOI_A	5.83e-13	2	139	3	143	Thecrystal structure of the putative dehydrogenase from Bordetella bronchiseptica RB50 [Bordetella bronchiseptica]
6JW6_A	4.55e-10	2	275	5	284	Thecrystal structure of KanD2 in complex with NAD [Streptomyces kanamyceticus],6JW6_B The crystal structure of KanD2 in complex with NAD [Streptomyces kanamyceticus],6JW7_A The crystal structure of KanD2 in complex with NADH and 3'-deamino-3'-hydroxykanamycin A [Streptomyces kanamyceticus],6JW7_B The crystal structure of KanD2 in complex with NADH and 3'-deamino-3'-hydroxykanamycin A [Streptomyces kanamyceticus],6JW8_A The crystal structure of KanD2 in complex with NADH and 3'-deamino-3'-hydroxykanamycin B [Streptomyces kanamyceticus],6JW8_B The crystal structure of KanD2 in complex with NADH and 3'-deamino-3'-hydroxykanamycin B [Streptomyces kanamyceticus]
3Q2I_A	5.42e-09	25	310	40	316	Crystalstructure of the WlbA dehydrognase from Chromobactrium violaceum in complex with NADH and UDP-GlcNAcA at 1.50 A resolution [Chromobacterium violaceum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4FN60	1.03e-48	2	370	61	443	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1
Q01S58	1.49e-44	2	370	43	429	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1
Q0HWR6	3.08e-44	1	370	54	445	Glycosyl hydrolase family 109 protein 1 OS=Shewanella sp. (strain MR-7) OX=60481 GN=Shewmr7_1440 PE=3 SV=1
Q0HKG4	3.08e-44	1	370	54	445	Glycosyl hydrolase family 109 protein 1 OS=Shewanella sp. (strain MR-4) OX=60480 GN=Shewmr4_1375 PE=3 SV=1
A4Y8C8	4.29e-44	1	370	54	445	Glycosyl hydrolase family 109 protein OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) OX=319224 GN=Sputcn32_2490 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002416_00399.