CAZyme Information: MGYG000002415_00264

Basic Information

• Species: Proteus sp001722135
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus sp001722135
• CAZyme ID: MGYG000002415_00264
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		43304.77	7.9304

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002415	4051274	Isolate	not provided	not provided

• Gene Location: Start: 84233; End: 85399 Strand: +

Full Sequence      

MSGQLSTIQRPLVIGLVAGETSGDILGAGLIRALKQKHSNVRFVGVAGPLMQAEGCEAWY
EMEELAVMGIVEVLERLPRLLKIRKDLTQRFTELKPDVFVGIDAPDFNITLEDRLKQKGI
KTIHYVSPSVWAWRQKRVFKIGKATDLVLAFLPFEKAFYDKYQVPCRFIGHTMADAIALN
PDKKAAREHLGISEDAPCLALLPGSRHAEVEMLSADFIKTAQLLKQQIPSLHIVVPLVNA
KRRAQFEQIHQNVAPELEIQLLDGQAREAMTASDATLLASGTAALECMLTKCPMVVGYRM
KPFTFWLAKRLVKTPYVSLPNLLAGREIIKELLQEECEPSALAQQLLPLLTDKEKVRQLK
EIFLQLHSAIRCNADEQAANAVLELVDK

Enzyme Prediction     

No EC number prediction in MGYG000002415_00264.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	14	371	1.8e-144	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	7	385	2	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	11	388	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	11	388	1	377	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	1.67e-172	14	382	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	1.28e-55	16	333	231	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQP26649.1	1.66e-271	1	388	3	390
QPB80642.1	1.66e-271	1	388	3	390
QIF88732.1	1.94e-270	1	388	3	390
QGW04260.1	1.94e-270	1	388	3	390
QKD73603.1	1.94e-270	1	388	3	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.72e-208	7	385	2	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.41e-207	7	385	2	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7N8N4	2.97e-222	10	388	11	389	Lipid-A-disaccharide synthase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=lpxB PE=3 SV=1
Q8ZH55	5.09e-215	10	388	16	394	Lipid-A-disaccharide synthase OS=Yersinia pestis OX=632 GN=lpxB PE=3 SV=1
Q667K2	5.09e-215	10	388	16	394	Lipid-A-disaccharide synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=lpxB PE=3 SV=1
A8GID3	3.82e-214	10	385	4	379	Lipid-A-disaccharide synthase OS=Serratia proteamaculans (strain 568) OX=399741 GN=lpxB PE=3 SV=1
B6HZF6	1.55e-213	7	385	2	380	Lipid-A-disaccharide synthase OS=Escherichia coli (strain SE11) OX=409438 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002415_00264.