CAZyme Information: MGYG000002414_02564

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_02564
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	MGYG000002414_1|CGC58	58729.61	5.6407

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 2923542; End: 2925197 Strand: -

Full Sequence      

MFDNVTVSDTNGTTPTPTPTSTPTPTATPLTTASPTPTATPIPTASPTPTATPIPTATPT
PTAIPTPTVTPTPTATPIPTATPIPTATPIPTATPIPTVSPTPTPVQVSEYDLAGFATGT
TGGGNIQETSPLYKKVYSAADLATALRKGSKIKVIEIMNDLDLGWNEISDAAKISPFSAH
NSALTHPVLIETGVSKLSIDNFDGLTIFSAKGATIKHAAFTFKRSSNVIIRNLEFDELWE
WDEATKGNYDKNDWDYITIENSNNVWIDHCTFNKSYDGVVDVKKGSNGVTISWSSFLGDD
RNANSWVTQQINAMEADKAAYPMYAYLRSSSVGLSKDDIIAIAASQKKGHLIGATEFAAD
NALLSVTLHHNYYKDIQDRMPRLRSGNAHAYNIVMDNEDTRLAKKRLTSAMEKAISSKGY
HFGVTSNGAISTEGGAVLLESSVIIDVVYPLRNNQADASNSKYTGAIAALDTIYSLDGAT
FRGDSTAKNSPLSPAPAAVKAFAWNGLTTLPYSYTSDDPASLKSRLTSVDGSGAGKLSWS
NKEWLITNYSN

Enzyme Prediction     

No EC number prediction in MGYG000002414_02564.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	199	423	2.5e-44	0.8217821782178217

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00656	Amb_all	1.45e-29	199	392	6	160	Amb_all domain.
COG3866	PelB	1.21e-25	209	537	108	344	Pectate lyase [Carbohydrate transport and metabolism].
pfam00544	Pec_lyase_C	8.70e-20	207	434	41	208	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV33413.1	0.0	1	551	1	551
ANY66001.1	4.74e-255	107	549	274	716
ANY65996.1	3.02e-242	109	547	253	691
ASA26290.1	5.31e-230	105	549	17	462
AEI39060.1	1.16e-229	111	549	35	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GT5_A	4.27e-224	109	549	5	446	Structuralbasis of the specific activity and thermostability of pectate lyase (pelN) from Paenibacillus sp. 0602 [Paenibacillus sp. 0602],5GT5_B Structural basis of the specific activity and thermostability of pectate lyase (pelN) from Paenibacillus sp. 0602 [Paenibacillus sp. 0602]
3ZSC_A	5.96e-21	206	392	71	210	Catalyticfunction and substrate recognition of the pectate lyase from Thermotoga maritima [Thermotoga maritima]
1VBL_A	2.68e-18	211	392	141	298	Structureof the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]
5AMV_A	5.91e-15	116	392	17	292	Structuralinsights into the loss of catalytic competence in pectate lyase at low pH [Bacillus subtilis],5X2I_A Polygalacturonate Lyase by Fusing with a Self-assembling Amphipathic Peptide [Bacillus subtilis subsp. subtilis str. 168]
1BN8_A	6.69e-15	116	392	38	313	BacillusSubtilis Pectate Lyase [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D3JTC2	5.43e-179	109	463	34	388	Pectate lyase B OS=Paenibacillus amylolyticus OX=1451 GN=pelB PE=1 SV=1
Q9WYR4	1.04e-20	206	392	98	237	Pectate trisaccharide-lyase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=pelA PE=1 SV=1
B1L969	3.34e-20	206	392	96	235	Pectate trisaccharide-lyase OS=Thermotoga sp. (strain RQ2) OX=126740 GN=pelA PE=3 SV=1
Q56806	4.72e-16	110	392	31	275	Pectate lyase OS=Xanthomonas campestris pv. malvacearum OX=86040 PE=3 SV=1
Q59671	2.78e-15	115	392	40	278	Pectate lyase OS=Pseudomonas fluorescens OX=294 GN=pel PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000013	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_02564.