CAZyme Information: MGYG000002414_01935

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_01935
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000002414_1|CGC42	35741.04	4.7687

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 2244179; End: 2245135 Strand: +

Full Sequence      

MLVVGKESFCAYHTIQEAIDSLEQGPSAQADTLYILSGVYKEAVRIYRSNLTIIGIGYVE
IVMNRYAKERDEAGEEINTFSTPTLFLGGSHLVLENLVITNNAGQGENIGQAVAVYANCD
QTVFRNCTLKGHQDTLFTGPLPPAPKERSTFGGIPLREHHSQYRQLYQHCYIEGTVDFIF
GGATAYFDKCEIRNLRHDENQAGYITAASTPKGQSYGYIFKNCFLTATPDIAPVFLGRPW
REYAKTVFVECQLGAHIDPLGWDNWNNTANEQTVSYQEYGVKDVILLSKQRVSWADCFED
GDETLDKEFVFAGTDFWR

Enzyme Prediction     

No EC number prediction in MGYG000002414_01935.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	3	297	8e-81	0.9305555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	3.90e-63	12	283	94	376	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	7.83e-59	3	295	3	275	Pectinesterase.
PLN02708	PLN02708	1.56e-46	4	295	245	526	Probable pectinesterase/pectinesterase inhibitor
PLN02301	PLN02301	2.82e-46	2	295	238	511	pectinesterase/pectinesterase inhibitor
PLN02773	PLN02773	2.70e-45	1	302	6	286	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV32857.1	7.00e-244	1	318	1	318
AIQ73518.1	8.09e-234	1	318	1	318
AIQ34935.1	7.06e-206	1	318	1	318
AIQ23084.1	3.65e-205	1	318	1	318
ASR46794.1	1.19e-184	2	318	1	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	6.37e-37	3	294	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.53e-31	2	294	9	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	7.71e-29	2	279	11	259	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	4.01e-28	2	279	11	259	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	7.45e-20	12	299	18	327	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.70e-37	1	295	6	279	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O04887	2.49e-37	2	294	203	472	Pectinesterase 2 OS=Citrus sinensis OX=2711 GN=PECS-2.1 PE=2 SV=1
P09607	5.44e-37	3	294	239	510	Pectinesterase 2.1 OS=Solanum lycopersicum OX=4081 GN=PME2.1 PE=2 SV=2
Q8L7Q7	2.27e-36	10	295	299	575	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q9LXD9	5.21e-36	2	317	241	546	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_01935.