CAZyme Information: MGYG000002414_01534

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_01534
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
739	MGYG000002414_1|CGC32	83433.17	4.939

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 1749726; End: 1751945 Strand: +

Full Sequence      

MSTYIPEYFPDPDCIAKSNGGKIENVLATVASRFIGAYPPQPPVYRVHSQSGFNRLRDCR
YDMNLEERLPELEVGQFVYVWGKLWSDNVVEAPFSVSCYSPVKVYINGRLVFSSNLNDDV
FPDRRTFFRAGMDKGWNHLVLEYVATGTGCGGVFGTGSVKGAPVHFLTPTAQLSGCEGWI
YSGPQQTSWAAWLKAEFTEEQMTARCAWFPTQQWSPQEQASGNCSRIFGEKLGAKAFAWC
NLEVNSLQKDDIRLQGSYRGMVEFSIYVNGELVAEHQNVTGMLDIHLELGYGLHDLVVES
VCGEENWGFELDVRSGGVQSSLVQPYSVEGLTDPWLYLGLFTSGTAPKVLELTSMDTLFG
EADEVTFWRVDQPNSWVRPYLENVMFGRWNYPLGVTLYGLLRTGVELKASHYAEYAQHHI
EQCTGMHEYALWDLGRYGAPGINHQLALMDSLDDCGSFGATMLEANKLRPLQGAPEAAAE
IANYITKVQSRLPDGALYRTSGTVDFMQQTMWCDDLYMSTPFLSKYYELTGNAAYLDDAA
AQFLHYKERLFQPELGIMHHVYDYKFNKPNGVPWGRGNGWVIFSLTELLEVMPEQHPLRA
DLLDYFRELSKGYLKLQDEHGLWHQVLTDPESYAEASCTSMFIYAFARGVRCGWLLEPES
YVTSALHGWSGLTRHCIDKQGNVYGVCRGSGYSFNKLYYKDELTWQLNDTHGIGIVLLAG
IEVHRLVRDLEMKSHNEAQ

Enzyme Prediction     

No EC number prediction in MGYG000002414_01534.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	386	725	1.9e-87	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.57e-61	362	726	2	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	6.66e-52	385	726	30	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV36611.1	0.0	15	739	1	725
AIQ73156.1	0.0	15	739	1	725
ASA19481.1	0.0	5	730	4	764
AIQ28407.1	0.0	1	734	1	763
AZK46358.1	0.0	8	730	4	751

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	2.91e-38	337	738	20	425	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	6.55e-25	388	728	38	369	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
4WU0_A	9.91e-25	511	726	127	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
2GH4_A	2.50e-24	388	728	28	359	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4CE7_A	1.89e-21	512	726	154	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.59e-24	388	728	38	369	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	2.02e-22	457	717	77	329	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
L7P9J4	1.13e-20	512	726	161	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	5.79e-18	512	723	201	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_01534.