CAZyme Information: MGYG000002412_02169

Basic Information

• Species: Prevotellamassilia timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia timonensis
• CAZyme ID: MGYG000002412_02169
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1262		139544.59	4.7323

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002412	3472293	Isolate	not provided	not provided

• Gene Location: Start: 345744; End: 349532 Strand: -

Full Sequence      

MRHYKHHFKSIKLFVVLLALACVQTLAAATQNPPAVTALLNRIGGDGTADRFVTIVDERI
SSNGKEAFVITRQDGKPCIKGSNISAVTTGINWYLNHYAHVNLSWNNLTTDLSSKTLPVP
TTDETHESSVDYRYYLNYCTFSYSMSVWTWDRWQKEIDWMALHGINMPLQIVGLDVVWRN
LLVNDLGYTKDEANAFIAGPCFQAWWGMNNLEGWGGPNPDWWYTRQEGLAKKILAREREL
GMQPVLPGYAGMVPSNIESKKGYKANNQGNWCEFVRPYILDPNSDAFTEISALYYKRLKE
LMGTSEYYSMDPFHEGANTKGIDVASAYSKIAGAMYKANSNGKWVIQFWQWSDAQYNVLD
KVEKGKLIVLDLFSDAHTHFNDYKGHDAVYCALPNFGGRTGLFGRLSKIMTDFFTQKSTY
SNIKGIGATPEAIEQVPVLYDALFELPWRSSAPDPKAWLAAYSTSRYGTANAKAEEAWEK
MRNSALNCQTALQGPHEAVLCARPNLSVGQVSSWGGTEIFYNAQDVLDAAYKMLQAKDEL
SGENYSYDLTDFARQALTDYGYYLLKGINEAATSNNATAYATRRDAYLQLILDLDALLNT
NSNFMLGRWTNMARNIADEANGTTGNDKQWLELNNARTLITTWGENSNSEGAGLRDYSYR
EWGGMLKDFYYKRWKAFFDNRDNGTTLPNWFDNDWAWAHNASLSYNNQPTGNTADVATEL
FGKYFITVNPANASSRCFYRYMSTDLGTALNVSATRGAAYTFPTTLPTGVTATLSIDFNN
DGTFGENETANGLTINVPTTAIATQVAARLTLSDGTAADFSILLKDNITTARTVSVNCDN
KQGSVAIEGSDALSVTNTEAVSLKATPAGSYDFKNWTDANGNVVSTANPYIYGGADAATF
TANFVSNKWAMPKEDLSEIGTIRDYNQYLKSLTFKQNNSDELNVYSTDECPSSLFHTTEM
AAAAKGSEIILHWLGAGGMGYTNLSAYIDLNSDGDFDDEGELIKVEGKKESEENTQFNDY
TLKVLLPYNMPEGITHIRLRLDGAWQDGYDAQTGAMPADNGLMRMAYDVPVDILPQSSAP
CTVTVKADDSGHGTADANGQTETYTYKAGESVVLRASPADGYRVYWTDQYGRRIPQSWIE
GNTIRFKASENGTYTANFEVSDLTFGSWKFDYQYDDNGITLTKVLSGEGELTIPASYEGR
PIVGIAPTALHGQTALTSLSLSENIKQLGGSGLVLKDITGAKIENAPIALPDTLKNLLAE
LI

Enzyme Prediction     

No EC number prediction in MGYG000002412_02169.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	74	721	1e-197	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	3.74e-158	133	450	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	9.84e-79	458	717	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	2.38e-18	35	118	2	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.
pfam18998	Flg_new_2	1.09e-04	859	907	23	73	Divergent InlB B-repeat domain. This family of domains are found in bacterial cell surface proteins. They are often found in tandem array. This domain is closely related to pfam09479.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12583.1	1.33e-231	11	725	6	718
ADV42401.1	1.38e-191	36	723	22	714
QRO24616.1	5.40e-191	36	721	22	712
QCQ31494.1	7.60e-191	15	680	6	669
QCQ35767.1	7.60e-191	15	680	6	669

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	1.25e-118	39	721	177	877	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.51e-118	39	721	185	885	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.51e-117	39	721	200	900	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	4.96e-90	31	725	4	712	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	3.33e-89	31	725	27	735	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	6.80e-86	64	725	76	805	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000939	0.429083	0.569345	0.000260	0.000183	0.000158

TMHMM  Annotations     

start	end
13	30