CAZyme Information: MGYG000002412_00798

Basic Information

• Species: Prevotellamassilia timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia timonensis
• CAZyme ID: MGYG000002412_00798
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1128		124948.41	5.4488

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002412	3472293	Isolate	not provided	not provided

• Gene Location: Start: 187898; End: 191284 Strand: -

Full Sequence      

MKVKHYIALAALTLPLAANAQSINFETENEGYTKLGVFDTWEKSPFRTGALEGNVKVIAN
PYKEKDALAGDTNMSDHVLAFQRSRWGSNTFGVRVTLKDTIKLSQTPQYVHVKMRKPKSG
RVMCFALGSRQDRPWQSKEVVQVEATCKSKVYTDKWFDAVFALTGASGVNVHSLVFAPDV
ESTHDLNEDFVTYIDDIEVNGSALTRIEYNVYPINFDKTATKENNNRYTSGATITSADGT
QTISTNQQSDKRLYQDRLSQSIKAKAGEKLSASVQYTGGWMNAYLYLDRNNDGKFNTSLN
ADGTPATSSDVLSYSNYKNKNSIGAGTGNCNTTALPDFTLPADLTPGFYRLRFKVDWDEI
DAGGNTTEANNIKHNSGVVIDTRLNVHGDKVNISRGQSAAGTNGEVLKADGSTLDGTQIE
FGKAYTIKFKPGDGFRLSRFTIRHGYNLTGDSLVNETPQYIDVTVPAYMVKDNLYTIPAE
YVDGDVMVTPEYVTDDAGSKGDYALNFPKDLKITRTDRALNSLSFNTTTQSTAQKLTPTS
KLVYQDFSNRSVYVKDGDVITTNVNYTPNKNAYMHVYLYVDLDNNGTFSTAVNADGTPAW
NGEMLSYLYYNNKNSRGENANNDARNGLFNATNSIPQFSLPQGLPKGKYRARVKIDWDDI
DPAGHYNNADGKNQINENGGYVVDFNFEVVDEYPMAKLDVRTTNGSIVGANNTGLSESIL
KGQEIAVQAVGLDENYSATSIVVRHGENLDGEQTVDGKKQWSEYTATLVDGKYTVPAENV
DGDVRITANFEDNGSEYKLVFGEEFDGENGSQPDSKYWSRSSRENPTWKRFCAQTEAGQK
ETGWIEDGKLVLRCLKNTHDGEKDGNGNKQQMISGSIESSNKVKFTYGKVEGRLMTIGHA
GNFPAFWMMPNNSVYGGWPYSGEIDIWEQIDAQTQTHHTIHTKWANSTKDGAECMGQGNN
PAKTGNSTATLGEYHVFGLEWTEDLLTWYLDGKQVFSYARKTDLTDENKIKAQWPFDQPF
YLILNQSVGNGGWAAAPDLNFTYETKFDWVRVYQTDKHATGANSATKTSALDYYVTPGNI
RLVAAQATKVQIFDLQGRVVFADMVQGNKDLHVNKGIYLVNGSKVLVP

Enzyme Prediction     

No EC number prediction in MGYG000002412_00798.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	803	1053	6.5e-52	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	2.82e-59	801	1053	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	6.15e-23	803	1053	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08024	GH16_CCF	8.25e-23	867	1029	90	275	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd02182	GH16_Strep_laminarinase_like	8.55e-23	797	1054	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd02178	GH16_beta_agarase	1.32e-18	791	1054	13	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12302.1	7.12e-156	1	787	5	778
QFQ13169.1	4.39e-91	502	1054	24	541
QKH89566.1	4.24e-66	781	1124	32	331
QUB87116.1	4.24e-66	766	1124	17	331
AKU69476.1	4.24e-66	766	1124	17	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	1.15e-27	797	1054	29	262	ChainAAA, Beta-glycosidase [Bacteroides caccae]
6XOF_A	2.72e-26	795	1054	22	267	ChainA, GH16 family protein [uncultured bacterium]
6XQF_A	1.25e-25	795	1054	22	267	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]
5WUT_A	1.91e-25	798	1054	6	235	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]
3ILN_A	5.15e-25	797	1054	5	248	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	1.65e-29	795	1061	54	295	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	5.39e-25	792	1054	35	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	4.75e-23	799	1054	425	680	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
C1IE32	3.24e-19	846	1037	65	245	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
Q27082	2.10e-17	839	1074	61	270	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000230	0.999066	0.000182	0.000174	0.000162	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002412_00798.