CAZyme Information: MGYG000002407_02918

Basic Information

• Species: Cohnella sp900169535
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Cohnella; Cohnella sp900169535
• CAZyme ID: MGYG000002407_02918
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481		54618.52	9.0575

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002407	6325359	Isolate	not provided	not provided

• Gene Location: Start: 170374; End: 171819 Strand: +

Full Sequence      

MRELLLGYGTVVMYYVMAVSLLYFVVLFLSYKGVYGMIKGAVYSRFRSLSGSEYAPPVSL
LVPAYNEELTIIENVKSLLTLSYHTYEVIVVNDGSKDNTLQVLIEAFRLRPKTDETVHYE
IDCTKIKTVYHNPDYPNLYVVDKSNGGKADSLNAGINLSHYPLICSIDADSLLEKDALIR
MSRVYMENPTETVAIGGNVRIANGCTIRDGDIADVRLPKKMWPMFQTLEYMKAFLGGRIG
WSHINGLIIVSGAFGMFRKDTVVKVGGYRDGYPGEDMNIIIKLHRYMLENKLPYRVAYCP
DAVCWTQAPDSYRILSSQRKRWGRGNLKNMLENRDLFFNPKYKVFGLLTVPYNVLFETLN
PYFKLTGLLALVGYVAMDMTQWPILLTFAIINFLNGYLLAVGSLVLEELAFRRYPSVKDT
FKMIGFAALMFLGYYQIGVLWRLQGHIEFLRKNNSWGVMTRQSWNQDSGTKPSTVTTGGE
A

Enzyme Prediction     

No EC number prediction in MGYG000002407_02918.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	56	325	4.7e-23	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	2.74e-63	60	276	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.77e-48	8	464	3	427	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	2.36e-41	13	401	4	351	N-glycosyltransferase; Provisional
PRK14583	hmsR	6.37e-24	4	352	22	326	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
pfam13641	Glyco_tranf_2_3	9.54e-23	56	325	2	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS80084.1	2.74e-255	11	470	2	461
QLG39516.1	2.24e-254	11	470	2	461
APO48386.1	4.87e-253	13	467	1	455
QKS60007.1	7.72e-253	11	468	2	459
QZN75219.1	2.21e-252	11	467	2	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	6.52e-07	55	285	12	185	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
5HEA_A	1.10e-06	58	191	7	115	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	1.77e-06	56	196	5	120	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9RQP9	3.79e-27	58	365	49	308	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q6GDD8	3.79e-27	58	365	49	308	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q5HCN1	3.79e-27	58	365	49	308	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q99QX3	3.79e-27	58	365	49	308	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1
Q7A351	3.79e-27	58	365	49	308	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	29
234	256
355	377
384	406
421	443