CAZyme Information: MGYG000002407_00970

Basic Information

• Species: Cohnella sp900169535
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Cohnella; Cohnella sp900169535
• CAZyme ID: MGYG000002407_00970
• CAZy Family: GT0
• CAZyme Description: UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		39509.92	5.3152

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002407	6325359	Isolate	not provided	not provided

• Gene Location: Start: 36403; End: 37476 Strand: -

Full Sequence      

MKIVFRTDASSLIGSGHVMRCLALADSLRANGFESIFVCRRLQGHLGEYIRNKGYDVEWI
ESNDDEFRPESDAIMTKEILARVASPIAWLIIDHYGIDRNWEIQMGSLANRILVIDDLAN
RPHLCDILVDQNAYERMESRYKDLLPPQCLQLLGPGYLLLRPSFYEARKSLRARDGSLRR
LLVFFGGSDPTNETAKALRALARRADDEPSFHTDVVIGSANPYRGEVTAMCAERPHAKLH
VQAENMAELIASADFALGAGGVAMWERCYLGLPSAVTVVADNQAASVRCAAQTGAVAYLG
ESAETNADTYARAIEKALESPSELLEMSKRALEITESRANRTESPVASAMLEMDRRG

Enzyme Prediction     

No EC number prediction in MGYG000002407_00970.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03590	PseG	1.52e-89	2	285	1	274	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase. This protein is found in association with enzymes involved in the biosynthesis of pseudaminic acid, a component of polysaccharide in certain Pseudomonas strains as well as a modification of flagellin in Campylobacter and Hellicobacter. The role of this protein is unclear, although it may participate in N-acetylation in conjunction with, or in the absence of PseH (TIGR03585) as it often scores above the trusted cutoff to pfam00583 representing a family of acetyltransferases.
COG3980	SpsG	5.55e-55	1	336	1	318	Spore coat polysaccharide biosynthesis protein SpsG, predicted glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	5.79e-10	16	334	11	338	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.94e-07	160	334	163	338	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	4.67e-06	2	338	1	351	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJD85205.1	3.57e-113	4	352	7	355
QMV41661.1	2.99e-112	2	351	6	355
AGE23687.1	7.86e-100	1	352	1	348
APM79566.1	1.58e-99	1	352	1	348
ANZ28829.1	1.58e-99	1	352	1	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HBM_A	2.27e-17	2	249	2	222	ChainA, UDP-sugar hydrolase [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819],3HBN_A Chain A, UDP-sugar hydrolase [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58462	1.38e-25	1	283	1	272	Uncharacterized protein MJ1062 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1062 PE=1 SV=1
A1W0U6	2.57e-18	1	254	1	227	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) OX=354242 GN=pseG PE=3 SV=1
Q0P8U5	9.05e-18	1	254	1	227	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pseG PE=1 SV=1
P39627	2.03e-15	154	300	140	284	Spore coat polysaccharide biosynthesis protein SpsG OS=Bacillus subtilis (strain 168) OX=224308 GN=spsG PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002407_00970.