CAZyme Information: MGYG000002406_01258

Basic Information

• Species: Corynebacterium pacaense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium pacaense
• CAZyme ID: MGYG000002406_01258
• CAZy Family: GT87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
796	MGYG000002406_12|CGC9	85583.61	10.5044

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002406	3028764	Isolate	not provided	not provided

• Gene Location: Start: 1327003; End: 1329393 Strand: -

Full Sequence      

MHAARPHTPAARVAMPIPLRRTLAVAACLASILALMPSVLNVRAIEDFNLFFHIDTEVYR
QGALAFLRGENLYTRDYSVGGIQLPFTYPPIAAAFFIPLALLPGNIAGVILTVLSAVLLW
WCLAIVTRRAVRGIDVADSRLLALVILPFALAAEPVFQTVQFGQINIILMTLVLMDTLTS
RPWLPRGFWIGLAASIKLTPAVFGLYFLVKRDWKGAGVCLASGIGFSALAWAIAPASSRI
YWTETLRNADRIGNLSYITNQSLQGVLHRLFSDGGLIELGWMLLVVLTLVGVGAAMYRAF
KAGNPVAALLLNSLIALLCSPVSWSHHWVWLVPISVVLLSSAWTQRHLAPATATTAGLLG
GLVAVAIIDPAFWNMPYHPQGGVGWPLILQPSGNSYVLLALAIVILSLLDPGIFGGAAKQ
KRGPRPAHIVVLIIAIGYQLANIWFRGDDSLRVHIKYPLMAINSLDLTSLGIALTPPVAG
TGALVLYGGLNLLGIVWSAVVIIRYLLGRKLTAFTLCLVILAALITFPVVAALQFGSVAI
AVLALVLTDLFVMRHRRARGLFTGVAAGIAGWPVLIAVTFLVQRRWRPAAVAAASTGLHW
GAGWLLNPPASALNLHTGWFTGRDGSRNLSPFAFIARWISDSAWAAGIWMVLALALGIWA
IHRSHRRGEETLSLALGIALPLLVLPSVEIFHWVLVLPLLVAVLASGRYVVAYLGVFITA
ISWTPSHLSWDILFPLNHPDLVGSVAQTWLYVLVEPMALAPSAILVALYVGGALPTGAST
RGGAISSGREETPLRR

Enzyme Prediction     

No EC number prediction in MGYG000002406_01258.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	86	321	6.2e-74	0.9956709956709957
GT87	483	684	7.2e-27	0.8961038961038961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	7.01e-39	1	346	4	334	mannosyltransferase; Provisional
pfam09594	GT87	5.86e-32	86	306	1	220	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.
pfam09594	GT87	5.94e-12	483	686	22	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.
PRK13375	pimE	5.69e-04	490	609	106	225	mannosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGG67276.1	6.22e-279	27	775	2	766
BAU96515.1	1.10e-273	19	770	28	788
APT07886.1	1.54e-271	19	776	28	794
ALC06363.1	2.53e-271	20	770	22	774
BAV23798.1	5.06e-271	19	776	22	788

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMZ8	7.63e-58	52	407	43	402	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	7.63e-58	52	407	43	402	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1
A0R036	1.56e-53	52	406	45	410	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4247 PE=1 SV=1
A0R2K8	2.37e-40	54	402	57	397	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimE PE=1 SV=2
P9WN00	4.20e-34	54	402	69	410	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.095160	0.900235	0.003087	0.000774	0.000372	0.000348

TMHMM  Annotations     

start	end
23	45
99	121
141	163
187	209
216	235
275	297
309	331
346	368
396	418
428	445
458	480
485	507
514	545
560	582
643	662
682	704
711	733
748	770