CAZyme Information: MGYG000002403_04026

Basic Information

• Species: Robinsoniella peoriensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella peoriensis
• CAZyme ID: MGYG000002403_04026
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494		53923.92	8.4251

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002403	7202103	Isolate	not provided	not provided

• Gene Location: Start: 32114; End: 33598 Strand: -

Full Sequence      

MNMEIKKMIAKTHCYIGRNKPGYVVMHETDNWNPGASALAHANAMRNGNLDGTVHFYVDS
KEIYQTLDFQDGAWAVGDGNGRYGISNLNSINIEICVNPESDYYTAVSNAQWLAAKLLKD
RGWSADRLKMHYDASRKHCPRRILDEGLWTEFVNKVQKQLSGTGPAATGTKITGKATATT
EQMQKYIRSKNPSVAQSVLDIVPQYIQEGKAEGIRGDIAFAQSCLETGNFTFKDSAVTLD
QNNFCGMGVTANGMKGNSFPNTKTGIRAQIQHLKAYACAEPLSKECVDPRFQYVERGCAE
YVEWLGIQENPKGKGWAAGSGYGSKILNILEAITGIKEEQPKPTPAPTPQPDQTGIYKVQ
AGSYKDKNLANSLAAVLKNKGFDAIVKEEAGQYKVQCGAFSNKGNATALADKIKGAGFDA
IVKGTEESVWVGKCTGDGVNVRKGPGTNYGNITGYPKLNSGNLVDVINKEDGWYQILIDK
KYSGFIAEQFVEKV

Enzyme Prediction     

No EC number prediction in MGYG000002403_04026.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	202	332	4.1e-18	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5632	CwlA	3.90e-30	20	173	23	182	N-acetylmuramoyl-L-alanine amidase CwlA [Cell wall/membrane/envelope biogenesis].
pfam01510	Amidase_2	1.72e-21	20	142	1	121	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
cd06583	PGRP	9.59e-21	20	142	1	125	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
smart00644	Ami_2	3.50e-20	20	140	2	126	Ami_2 domain.
pfam05036	SPOR	9.41e-11	355	423	3	75	Sporulation related domain. This 70 residue domain is composed of two 35 residue repeats found in proteins involved in sporulation and cell division such as FtsN, DedD, and CwlM. This domain is involved in binding peptidoglycan. Two tandem repeats fold into a pseudo-2-fold symmetric single-domain structure containing numerous contacts between the repeats. FtsN is an essential cell division protein with a simple bitopic topology, a short N-terminal cytoplasmic segment fused to a large carboxy periplasmic domain through a single transmembrane domain. These repeats lay at the periplasmic C-terminus. FtsN localizes to the septum ring complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW80001.1	1.12e-113	3	494	1	501
QIB57222.1	1.12e-113	3	494	1	501
AFC63685.1	6.83e-85	5	494	4	498
ADL53623.1	1.00e-84	38	494	37	488
QUO23193.1	1.45e-81	174	494	2	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HMB_A	3.00e-26	20	152	25	152	ChainA, N-acetylmuramoyl-L-alanine amidase xlyA [Bacillus subtilis],3HMB_B Chain B, N-acetylmuramoyl-L-alanine amidase xlyA [Bacillus subtilis],3HMB_C Chain C, N-acetylmuramoyl-L-alanine amidase xlyA [Bacillus subtilis]
1YB0_A	7.83e-19	3	157	1	155	Structureof PlyL [Bacillus anthracis],1YB0_B Structure of PlyL [Bacillus anthracis],1YB0_C Structure of PlyL [Bacillus anthracis]
2L47_A	1.69e-18	3	157	1	155	Solutionstructure of the PlyG catalytic domain [Bacillus phage Gamma]
2AR3_A	5.19e-18	3	157	1	155	ChainA, prophage lambdaba02, n-acetylmuramoyl-l-alanine amidase, family 2 [Bacillus anthracis],2AR3_B Chain B, prophage lambdaba02, n-acetylmuramoyl-l-alanine amidase, family 2 [Bacillus anthracis],2AR3_C Chain C, prophage lambdaba02, n-acetylmuramoyl-l-alanine amidase, family 2 [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54450	6.97e-26	21	168	23	164	N-acetylmuramoyl-L-alanine amidase CwlH OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlH PE=1 SV=1
O51481	2.26e-22	181	330	50	192	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1
P24808	3.32e-21	20	193	24	194	N-acetylmuramoyl-L-alanine amidase CwlA OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlA PE=1 SV=1
O34391	1.77e-20	23	162	27	163	N-acetylmuramoyl-L-alanine amidase XlyB OS=Bacillus subtilis (strain 168) OX=224308 GN=xlyB PE=3 SV=1
P14892	8.12e-14	3	161	1	160	N-acetylmuramoyl-L-alanine amidase CwlA OS=Bacillus sp. OX=1409 GN=cwlA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002403_04026.