CAZyme Information: MGYG000002403_03844

Basic Information

• Species: Robinsoniella peoriensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella peoriensis
• CAZyme ID: MGYG000002403_03844
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438	MGYG000002403_106|CGC4	50230.79	4.7018

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002403	7202103	Isolate	not provided	not provided

• Gene Location: Start: 113285; End: 114601 Strand: -

Full Sequence      

MMFSKDFMLGAATAAHQVEGNNIHSDYWVQEQISHSMFNEPSLDSVDHYHRYEEDIHLMA
EAGLNTYRFSIEWARIQPEPDTWDEAEVQHYRNVLDCCYANHVRPIVTMHHFSSPKWLIS
QGGWENPEVVEKFAAYCKRLANELGDKMEYVCTINEANMRLQLAALMKEMVLRMGGQQTD
ADKEIGDKKSAAQESDVQVGINMNKENMMLSMMESAQAFGLQNPMDVHTFVSMCTPEGDL
LVMKAHEAARDAMKEACPHLKIGLTLSLHDMQPYPGGEAFAEKEWDEEFKHYLPYIKDDD
YLGIQCYTRKRFDENGGAQAKDECLRTQMGYEDYPLAIVNVTRKVADEFKGDLIITENGI
ATADDSRRCQFIREVTEGIQACIDDGIRVKGYMYWSLLDNFEWQKGYGMKFGLIGVDRST
QTRYPKESLQVLGSLMER

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	436	6.2e-112	0.9790209790209791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.10e-87	1	428	2	442	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
TIGR03356	BGL	6.22e-76	5	428	2	422	beta-galactosidase.
pfam00232	Glyco_hydro_1	2.09e-68	3	438	5	450	Glycosyl hydrolase family 1.
PRK13511	PRK13511	8.67e-46	1	428	1	455	6-phospho-beta-galactosidase; Provisional
PRK09593	arb	1.85e-31	1	429	4	463	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK75894.1	1.21e-197	2	435	1	433
AXB29242.1	3.42e-180	3	438	4	433
AIQ16638.1	3.42e-179	7	433	3	414
CBL02685.1	2.62e-177	3	433	4	428
QTE67958.1	1.37e-174	1	433	1	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4R27_A	2.71e-106	3	434	7	407	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
6IER_A	6.09e-76	7	435	36	427	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
6Z1H_A	2.56e-60	1	428	9	437	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
1VFF_A	1.22e-58	1	435	3	402	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
7E5J_A	4.14e-49	3	428	6	433	ChainA, Beta-glucosidase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P22073	4.76e-45	3	428	6	431	Beta-glucosidase A OS=Paenibacillus polymyxa OX=1406 GN=bglA PE=1 SV=1
Q03506	4.95e-45	2	428	5	435	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3
P10482	2.03e-44	1	428	3	443	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
B9K7M5	1.61e-40	3	428	4	429	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
P0C946	1.12e-39	3	423	4	424	1,4-beta-D-glucan glucohydrolase (Fragment) OS=Thermotoga neapolitana OX=2337 GN=bglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002403_03844.