CAZyme Information: MGYG000002402_02286

Basic Information

• Species: Clostridium_H massiliodielmoense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_H; Clostridium_H massiliodielmoense
• CAZyme ID: MGYG000002402_02286
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268		29512.74	10.0204

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002402	2759335	Isolate	not provided	not provided

• Gene Location: Start: 1208888; End: 1209694 Strand: +

Full Sequence      

MLRNKRLNKFIATMSVSLLLSQSVFAATYKVVPNDSLYKIGKLFNTSVTSIKNNNNLKGD
IIYPGQALNVPAKVHNVVSGESLYLISKKYNISLDSLRKANNKWDNLIYPNDKLLIPSLN
VTSTNSATTKPSSTSVQASTTPKSVIPYTQDDLDVLSRLVHAEAGGESYKTRVCVASVVI
NRVKSNQFPNSIKGVVYEVSDGHYQFTPVLNGMINKPATEEDKKAALEALNGNDPTKGAL
YFFDNTVTNKWLLSKPVALHSDKMTFAY

Enzyme Prediction     

No EC number prediction in MGYG000002402_02286.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07486	Hydrolase_2	5.56e-37	166	259	1	92	Cell Wall Hydrolase. These enzymes have been implicated in cell wall hydrolysis, most extensively in Bacillus subtilis. For instance Bacillus subtilis steB is expressed during sporulation as an inactive form and then deposited on the cell outer cortex. During germination the the enzyme is activated and hydrolyzes the cortex. A similar role is carried out by the partially redundant Bacillus subtilis CwlJ. It is not clear whether these enzymes are amidases or peptidases.
COG3773	CwlJ	7.17e-32	93	268	53	242	Cell wall hydrolase CwlJ, involved in spore germination [Cell cycle control, cell division, chromosome partitioning, Cell wall/membrane/envelope biogenesis].
PRK06347	PRK06347	1.84e-17	26	159	330	493	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	1.70e-16	21	143	400	554	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	2.68e-13	21	116	474	591	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABK60512.1	4.28e-132	1	268	1	274
AEB75346.1	6.90e-113	1	268	1	267
QPW57265.1	1.39e-112	1	268	1	267
QPW60041.1	1.39e-112	1	268	1	267
AYF53444.1	2.73e-111	1	268	1	262

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F55_A	6.10e-24	148	256	11	116	CrystalStructure of the Catalytic Domain of the Bacillus cereus SleB Protein [Bacillus cereus ATCC 14579]
4FET_A	3.26e-22	148	256	105	210	Catalyticdomain of germination-specific lytic tansglycosylase SleB from Bacillus anthracis [Bacillus anthracis],4FET_B Catalytic domain of germination-specific lytic tansglycosylase SleB from Bacillus anthracis [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31685	4.69e-23	148	267	91	207	Uncharacterized protein YkvT OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvT PE=2 SV=1
P0A3V0	7.10e-22	148	256	142	247	Spore cortex-lytic enzyme OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=sleB PE=1 SV=1
P0A3V1	7.10e-22	148	256	142	247	Spore cortex-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleB PE=1 SV=1
Q9KCE0	3.73e-19	148	256	213	318	Spore cortex-lytic enzyme OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=sleB PE=3 SV=1
P59105	1.26e-18	141	256	150	264	Spore cortex-lytic enzyme OS=Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) OX=221109 GN=sleB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000306	0.998996	0.000187	0.000167	0.000164	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002402_02286.