CAZyme Information: MGYG000002402_02061

Basic Information

• Species: Clostridium_H massiliodielmoense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_H; Clostridium_H massiliodielmoense
• CAZyme ID: MGYG000002402_02061
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
201		23588.74	9.9505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002402	2759335	Isolate	not provided	not provided

• Gene Location: Start: 952702; End: 953307 Strand: -

Full Sequence      

MKKRKLTAIWIILILLILMVISIKPIGRKFYPMKYKEYIMKYSEQYDLDPYLVASVIKTE
SNFEKNAKSNKGAIGLMQLTPSTAKWAAKQMKVKSFKVDMLYDEEFNIKMGCWYLDNLKQ
EFQSNMKLVIAAYNGGRGNVKKWLNNEENSKNGVDLHYIPFKETDKYLKKVQVNCNVYEF
LYKDDKGYIKGIKEVISSYFS

Enzyme Prediction     

No EC number prediction in MGYG000002402_02061.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	44	175	1.3e-28	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.35e-76	32	171	1	140	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.05e-52	31	181	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	6.94e-38	50	171	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	5.37e-34	31	182	135	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	2.36e-31	37	171	1	157	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABK61046.1	1.19e-129	1	201	1	201
AEB75546.1	4.76e-120	1	201	1	201
QPW59871.1	2.26e-118	1	201	1	201
AYF53303.1	8.80e-116	1	201	1	201
QPW55971.1	5.93e-114	1	201	1	201

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.70e-21	35	182	416	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.71e-21	35	182	420	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.73e-21	35	182	426	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.74e-21	35	182	430	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.75e-21	35	182	436	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O64046	5.41e-21	31	174	1418	1540	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	5.41e-21	31	174	1418	1540	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O31608	1.97e-17	39	171	64	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P44888	1.05e-12	32	183	425	573	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
Q6D8K0	7.83e-11	34	171	190	348	Membrane-bound lytic murein transglycosylase C OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.686240	0.308318	0.003409	0.000522	0.000317	0.001204

TMHMM  Annotations     

start	end
7	26