CAZyme Information: MGYG000002400_02283

Basic Information

• Species: Staphylococcus lugdunensis
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus lugdunensis
• CAZyme ID: MGYG000002400_02283
• CAZy Family: CBM50
• CAZyme Description: N-acetylmuramoyl-L-alanine amidase sle1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000002400_36|CGC4	35406.81	10.2726

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002400	2523999	Isolate	not provided	not provided

• Gene Location: Start: 274966; End: 275937 Strand: +

Full Sequence      

MKKKYMAAIIGTSALSTVFAHQAEAATTHTVKAGESVWSISHKYGMSIARLKSLNGLKSN
LIFPNQVLKVSGSSKSTANRTANTSSSTYTVQPGDSLSLIASKYNTTYQKIMQLNGLNNF
FIYPGQKLKVTGTAAKNNTKPSQSSKSSIYTVQPGDSLSLIASKYNTTYQKIMQLNGLNN
FFIYPGQKLKVTGTASGSSTRTSNSNSYRTPIFSHSNLYTWGQCTWHVFNRRAAIGKGIS
TYWWNANNWDNAAAADGYTINYTPTVGSIAQTDIGYYGHVAFVERVNSDGSILVSEMNYS
ASPGIMTYRTIPSYQVSSYRYIH

Enzyme Prediction     

No EC number prediction in MGYG000002400_02283.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	89	130	3.9e-16	0.95
CBM50	150	191	3.9e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	1.94e-33	26	196	330	528	1,4-beta-N-acetylmuramoylhydrolase.
COG3942	COG3942	1.07e-32	208	323	57	171	Surface antigen [Cell wall/membrane/envelope biogenesis].
PRK06347	PRK06347	1.18e-32	26	191	405	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK10783	mltD	2.33e-18	45	189	282	444	membrane-bound lytic murein transglycosylase D; Provisional
PRK08581	PRK08581	4.28e-18	219	322	508	616	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEX32614.1	1.34e-230	1	323	1	323
QEX38173.1	1.34e-230	1	323	1	323
BBN86345.1	1.34e-230	1	323	1	323
AMG64511.1	1.34e-230	1	323	1	323
ARJ12368.1	1.34e-230	1	323	1	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2K3A_A	1.33e-35	200	323	33	153	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
2LRJ_A	2.47e-33	214	323	5	112	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
5T1Q_A	5.44e-18	214	322	243	356	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
4UZ2_A	1.27e-08	88	130	4	46	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	7.30e-07	88	130	4	46	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2YVT4	1.30e-172	1	323	1	335	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=sle1 PE=3 SV=1
Q6GC24	2.52e-172	1	323	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=sle1 PE=3 SV=1
Q7A1T4	2.52e-172	1	323	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MW2) OX=196620 GN=sle1 PE=3 SV=1
Q5HIL2	2.52e-172	1	323	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain COL) OX=93062 GN=sle1 PE=3 SV=1
P0C1U7	2.52e-172	1	323	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus OX=1280 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000244	0.999064	0.000170	0.000192	0.000171	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002400_02283.