CAZyme Information: MGYG000002399_00268

Basic Information

• Species: Staphylococcus hominis
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus hominis
• CAZyme ID: MGYG000002399_00268
• CAZy Family: CBM50
• CAZyme Description: N-acetylmuramoyl-L-alanine amidase sle1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	MGYG000002399_9|CGC1	36255.04	9.9646

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002399	2175331	Isolate	not provided	not provided

• Gene Location: Start: 58634; End: 59623 Strand: +

Full Sequence      

MNKKVLATAIIGTGAFSTIFAHQAEAATTHTVKSGESLWSISNRYGITIAKLKSLNGLTS
NLIFPNQVLTVSGSSSSHSYSNNSSSTYTVKSGDSLSSIASRYGTTYRHIMELNGLHSFL
IFPGQTLKVSGTARSSSHTQSSSNSSSSSSYYTVRYGDSLSGIAWKYNTTYQNIMRLNGL
NNFFIYPGQTLRVSGTASSSSNTNSTSSSSNYYYHTPIFNHRNLYDWGQCTWHVFNRRAQ
IGKGISTYWWNANNWDNAAARDGYRIDYHPTVGSIAQSDAGYYGHVAFVERVNSNGSILV
SEMNFSAGPGILTYRTIPAYQVRQYKFIH

Enzyme Prediction     

No EC number prediction in MGYG000002399_00268.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	152	194	8.5e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	1.45e-34	216	329	59	171	Surface antigen [Cell wall/membrane/envelope biogenesis].
PRK06347	PRK06347	4.78e-28	27	194	330	524	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	1.07e-26	27	193	405	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	9.81e-23	225	319	508	607	amidase domain-containing protein.
PRK10783	mltD	2.52e-16	87	197	345	452	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUW63711.1	1.35e-217	1	329	1	329
AVI06068.1	7.81e-217	1	329	1	329
QDW87647.1	1.11e-216	1	329	1	329
QKW68035.1	3.04e-214	1	329	1	329
QGR77376.1	1.76e-213	1	329	1	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2K3A_A	5.58e-31	223	329	50	153	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
2LRJ_A	5.17e-29	223	329	9	112	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
5T1Q_A	5.00e-19	225	328	248	356	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
4UZ2_A	4.13e-10	87	135	4	52	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	2.88e-08	87	135	4	52	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4L3C1	9.79e-168	1	329	1	329	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=sle1 PE=3 SV=1
Q5HRU2	4.91e-155	1	329	1	324	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q8CMN2	4.91e-155	1	329	1	324	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q6GJK9	1.90e-152	1	329	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=sle1 PE=3 SV=1
Q5HIL2	5.13e-150	1	329	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain COL) OX=93062 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000285	0.998888	0.000191	0.000222	0.000211	0.000175

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002399_00268.