CAZyme Information: MGYG000002398_02777

Basic Information

• Species: Laribacter hongkongensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Aquaspirillaceae; Laribacter; Laribacter hongkongensis
• CAZyme ID: MGYG000002398_02777
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
202		22468.47	6.2192

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002398	3424272	Isolate	China	Asia

• Gene Location: Start: 2863295; End: 2863903 Strand: -

Full Sequence      

MEAPMEPRIDVHLLTLNEPAEWREACIASLDGAPIQLHVLPGIPGRIGEARAAGYAQGTL
PLVSFVDPDDLYEASAFTQLADALDACPQAVMAYTDEALTDENGQDIAVRRLAYSRWQHA
NSASHVHGLIVMRRSAVEAVLKETTDLNNFADWLLTLLVAKRGGVLYLPIVGRHWRQHPQ
QSHRTGDPEAVRRIRHTSNLWR

Enzyme Prediction     

No EC number prediction in MGYG000002398_02777.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04196	GT_2_like_d	8.74e-10	63	178	83	205	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04184	GT2_RfbC_Mx_like	1.18e-06	7	176	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR91102.1	1.67e-140	5	202	1	198
QNG87477.1	2.37e-140	5	202	1	198
QIQ10533.1	2.37e-140	5	202	1	198
QNG89277.1	2.37e-140	5	202	1	198
APZ43123.1	2.37e-140	5	202	1	198

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002398_02777.