CAZyme Information: MGYG000002392_02434

Basic Information

• Species: Listeria monocytogenes
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria monocytogenes
• CAZyme ID: MGYG000002392_02434
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	MGYG000002392_5|CGC4	38052.91	6.0479

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002392	2941624	Isolate	not provided	not provided

• Gene Location: Start: 257717; End: 258742 Strand: +

Full Sequence      

MKMRKLFPLLIVGFFFVFFMLVAGSSSSTTNTASEEGQNLPEAVLRWKDKITKEAIKNEI
SEAIPYLLGIIMAESGGNSEKYPDVMQCSESQGKPPNSIQDPNESIEVGVKYFADMWKGH
REYDVLNIVQAYNFGGGFLSHSGKSYSLDHAIQFSKNQAGGKTVTYTNPIAVNLGYDYRY
AYGNMFYAQIVKQYITSTSSNNSQGNSAIVKSALKELDEGTHEGGMKYWQWYGFNGRVEW
CAIFVSYNAEKAGVIMERFAYCPTGIENFKAKNQWLGKGNLPKSGNIIFFDWDGDSISDH
VGIVEKVENAIIFTIEGNSGDKIAKQNYEKNSPYIMGYGTP

Enzyme Prediction     

No EC number prediction in MGYG000002392_02434.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16891	CwlT-like	1.27e-61	47	195	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13702	Lysozyme_like	3.31e-47	41	194	1	164	Lysozyme-like.
pfam05257	CHAP	1.16e-08	232	318	1	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.
cd00254	LT-like	2.37e-04	67	147	4	93	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	5.68e-04	51	139	1	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEE97008.1	6.03e-227	1	341	1	341
QCS45677.1	6.03e-227	1	341	1	341
AUC58727.1	1.73e-226	1	341	1	341
ALQ23426.1	5.53e-223	32	341	32	341
QCJ36764.1	5.53e-223	32	341	32	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	4.67e-37	37	303	17	272	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	2.12e-34	37	303	19	276	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	1.14e-20	44	303	57	293	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
Q8DPY9	1.77e-08	67	192	54	188	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pvaA PE=4 SV=1
Q9AHT6	1.77e-08	67	192	54	188	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pvaA PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003725	0.738948	0.256520	0.000284	0.000251	0.000245

TMHMM  Annotations     

start	end
7	24