CAZyme Information: MGYG000002385_00621

Basic Information

• Species: Leminorella richardii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Leminorella; Leminorella richardii
• CAZyme ID: MGYG000002385_00621
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	MGYG000002385_1|CGC6	45169.99	8.3418

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002385	3976274	Isolate	not provided	not provided

• Gene Location: Start: 648595; End: 649803 Strand: +

Full Sequence      

MQRLLDIIPPGVERIDLLAPPFSGHLHPVLAMGKALSAYYQVRIVSTRGAIARIQAAGLP
MLILEGEYDTPLLSVVNPQYAVKSHPVRLYRQFRSVVSLLKGFADELEQVWRQEGTPDLA
IADFTLPVVGEVCRRLNISWWSSLPSPCVMEAPDGTPAYCGGLMPAKGFVDRLWHFVHRK
KVRLFKRSVFWLFRDVIRQTGITRLYRADGSENAYSPTRILALSEEAFEFPRSWPASVTF
IGPALYTPPTGGEPPPFVEGKRHVLITLGTHLDWHKDAVAKAVMALAHTLPDWEFHFTDG
HPAGEEQRRQGNFSRVAWVDYDLWLTRYDAVIHHGGAGIMWHCLKKNVPALVYPVDYDQF
DHAARLEYSGRGVWIRGGLGSLERAGSQLVKLVSECDREAKG

Enzyme Prediction     

No EC number prediction in MGYG000002385_00621.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	39	376	3.2e-23	0.8167539267015707

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	1.02e-41	14	384	3	357	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	1.27e-25	14	385	2	368	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
TIGR01426	MGT	8.39e-07	21	376	4	340	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQI36149.1	4.37e-310	1	402	1	402
AHG18365.1	5.66e-249	1	401	1	401
QPS93364.1	2.22e-226	1	393	1	393
AWC86162.1	2.14e-225	1	393	15	407
QCA18968.1	2.27e-225	1	401	1	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D0R_A	1.16e-06	252	373	223	345	Crystalstructure of calG3 from Micromonospora echinospora determined in space group P2(1) [Micromonospora echinospora],3D0R_B Crystal structure of calG3 from Micromonospora echinospora determined in space group P2(1) [Micromonospora echinospora],3OTI_A Crystal Structure of CalG3, Calicheamicin Glycostyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora],3OTI_B Crystal Structure of CalG3, Calicheamicin Glycostyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora]
3D0Q_A	2.72e-06	252	373	223	345	Crystalstructure of calG3 from Micromonospora echinospora determined in space group I222 [Micromonospora echinospora],3D0Q_B Crystal structure of calG3 from Micromonospora echinospora determined in space group I222 [Micromonospora echinospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8KHE4	7.43e-10	14	376	4	371	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
A0A1B4XBH6	4.32e-06	235	374	268	431	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002385_00621.