CAZyme Information: MGYG000002383_02602

Basic Information

• Species: Lacticaseibacillus zeae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus zeae
• CAZyme ID: MGYG000002383_02602
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000002383_23|CGC1	35906.66	6.8953

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002383	3001027	Isolate	Italy	Europe

• Gene Location: Start: 11718; End: 12728 Strand: -

Full Sequence      

MKTHSKRWLLRLIFGSLSSFVLFFVLFMVLIAAMFAGLNDKKGGGSDCDITGSISATGNF
NKDTYQQAWTKYFTSGVLKYEADYTIKAANKAGVSPALFASIMGHESGWGKSSAVRNQNN
PSGQMSGSTVISYPTIEAGIDATAATLHNLVVERQLSTVEKLGSVYCPVGATNDPTGLNS
SWVPSVKKTMLEFGADASATLATTCNSGAGSVGNGSAIITEAKKYLGVPYVWGGKSPATG
MDCSGFVGYVLMQVTHKSYPQYTVSLESKGTMLFNGGKPVMSELQPGDMIFYGDHGASHH
IAFYAGDGQVIEEPEPNDVCHIRPYKDYEPDFAVRP

Enzyme Prediction     

No EC number prediction in MGYG000002383_02602.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0791	Spr	1.03e-18	162	324	17	181	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
pfam00877	NLPC_P60	1.96e-17	227	314	1	81	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK13914	PRK13914	2.22e-16	172	311	321	454	invasion associated endopeptidase.
NF033741	NlpC_p60_RipA	1.46e-15	218	324	331	441	NlpC/P60 family peptidoglycan endopeptidase RipA.
NF033742	NlpC_p60_RipB	3.05e-11	195	312	54	178	NlpC/P60 family peptidoglycan endopeptidase RipB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE43723.1	6.45e-240	1	336	1	336
QOP54548.1	9.16e-240	1	336	1	336
QBA75848.1	3.73e-239	1	336	1	336
QTH67767.1	3.06e-238	1	336	1	336
QKK92482.1	3.06e-238	1	336	1	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B8C_A	1.70e-28	210	334	24	140	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
3NE0_A	2.72e-11	139	326	34	200	Structureand functional regulation of RipA, a mycobacterial enzyme essential for daughter cell separation [Mycobacterium tuberculosis H37Rv]
3PBC_A	2.72e-11	139	326	34	200	ChainA, Invasion Protein [Mycobacterium tuberculosis]
7CFL_A	4.43e-11	218	311	17	107	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
3S0Q_A	9.40e-11	139	326	35	201	ChainA, INVASION PROTEIN [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13692	1.56e-25	210	334	398	514	Protein P54 OS=Enterococcus faecium OX=1352 PE=3 SV=2
Q01835	9.06e-13	206	312	387	485	Probable endopeptidase p60 OS=Listeria grayi OX=1641 GN=iap PE=3 SV=1
Q736M3	3.17e-11	218	324	214	315	Gamma-D-glutamyl-L-lysine dipeptidyl-peptidase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=ykfC PE=1 SV=1
P96740	7.91e-11	218	328	169	275	Gamma-DL-glutamyl hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=pgdS PE=1 SV=2
Q01838	1.29e-10	218	311	411	496	Probable endopeptidase p60 OS=Listeria seeligeri OX=1640 GN=iap PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000013	0.000000	0.000000	0.000000	0.000004

TMHMM  Annotations     

start	end
12	34