CAZyme Information: MGYG000002383_01791

Basic Information

• Species: Lacticaseibacillus zeae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus zeae
• CAZyme ID: MGYG000002383_01791
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		34040.34	9.9299

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002383	3001027	Isolate	Italy	Europe

• Gene Location: Start: 467819; End: 468757 Strand: +

Full Sequence      

MRGSFSKHQGLKKRQYRVPRSLLYSSAVLSLTATAIYYTSTIPVSAVKADPGTSKATTKA
ATSNLQIVSVTKQAHYFEITYSNNLKARLFILADNQFRFYADPSGKFDAPAQSGDGLNAK
IFTKTVDTSATKPFDAAQLANVAKGWQIQTKAITIDFDKAAATLQVLQGNKVVMAEQQPL
EITADHTTQILKRSGQDHFFGGGTQNGNFTLTGKKIKIQNTNNWVDGGVASPNPFYWSTA
GYGVVRNTFTPGAYDFDAAGDGQVKTTHQEERFNAVYFFDAKPADLLKDYYNLTGAPAMM
PRTGDDAAVRLL

Enzyme Prediction     

No EC number prediction in MGYG000002383_01791.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14752	GH31_N	2.80e-19	180	295	3	122	N-terminal domain of glycosyl hydrolase family 31 (GH31). This family is found N-terminal to the glycosyl-hydrolase domain of Glycoside hydrolase family 31 (GH31). GH31 includes the glycoside hydrolases alpha-glucosidase (EC 3.2.1.20), alpha-1,3-glucosidase (EC 3.2.1.84), alpha-xylosidase (EC 3.2.1.177), sucrase-isomaltase (EC 3.2.1.48 and EC 3.2.1.10), as well as alpha-glucan lyase (EC 4.2.2.13). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite-1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed. Most characterized GH31 enzymes are alpha-glucosidases. In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes. The lysosomal acid alpha-glucosidase (GAA) is essential for glycogen degradation and a deficiency or malfunction of this enzyme causes glycogen storage disease II, also known as Pompe disease. In the endoplasmic reticulum, alpha-glucosidase II catalyzes the second step in the N-linked oligosaccharide processing pathway that constitutes part of the quality control system for glycoprotein folding and maturation. The intestinal enzymes sucrase-isomaltase (SI) and maltase-glucoamylase (MGAM) play key roles in the final stage of carbohydrate digestion, making alpha-glucosidase inhibitors useful in the treatment of type 2 diabetes. GH31 alpha-glycosidases are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues of the catalytic domain have been identified as the catalytic nucleophile and the acid/base, respectively. A loop of the N-terminal beta-sandwich domain is part of the active site pocket.
COG1501	YicI	1.24e-07	126	302	88	263	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam13802	Gal_mutarotas_2	7.93e-05	197	255	2	67	Galactose mutarotase-like. This family is found N-terminal to glycosyl-hydrolase domains, and appears to be similar to the galactose mutarotase superfamily.
PRK10658	PRK10658	1.73e-04	197	301	159	264	putative alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARY92779.1	1.60e-189	8	304	2	298
QVI36610.1	2.10e-188	8	304	2	298
QXG58403.1	2.10e-188	8	304	2	298
QVI34630.1	3.31e-180	8	304	2	298
QFV11154.1	4.15e-138	8	304	2	300

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M76_A	1.87e-65	60	304	33	280	GH31alpha-N-acetylgalactosaminidase from Enterococcus faecalis [Enterococcus faecalis ATCC 10100],6M77_A GH31 alpha-N-acetylgalactosaminidase from Enterococcus faecalis in complex with N-acetylgalactosamine [Enterococcus faecalis ATCC 10100]
7F7Q_A	1.87e-65	60	304	33	280	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
7F7R_A	1.87e-65	60	304	33	280	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.260463	0.726114	0.002663	0.007672	0.001794	0.001281

TMHMM  Annotations     

start	end
21	43