CAZyme Information: MGYG000002381_01623

Basic Information

• Species: Stenotrophomonas bentonitica_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas bentonitica_A
• CAZyme ID: MGYG000002381_01623
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000002381_20|CGC6	42266.59	10.1571

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002381	4114425	Isolate	not provided	not provided

• Gene Location: Start: 181136; End: 182299 Strand: +

Full Sequence      

MRDPSVPAPAPARRRFLQAMAAAGAAAVLPLDVLAQACGTPWREWRAFVDRHIEPDGRVV
DHLNTDLRSTSESQSYGLFFALVDNDPVLFDRILAWTRRHLCRGRADLNLPAWLWGRAAD
GQFRVLDPNTAADGELWIAYALLEAGRLWKRPGLVEAGRQTLALMRTAEVVELPGFGPML
LPGNRGFVQADRWTLNPSYLPLFVLRRFAAVDARGPWARLAERSVAMTRASAPVGFAPDW
IAWNGKAFVADPGKGAIGSYDAIRCYLWAGMTDPADPLRRTLLDGLSGPASMLRAQSGFA
EKIDTRLGVGTGTPSTGFAAALLPYLSALGQPALAKAQLARIPAAGTLNYYDRALVLFGK
GWMDRRYRFSADGRLLPAWSSPCSARP

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	42	363	1.7e-79	0.996875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	4.87e-166	28	387	11	376	cellulase.
COG3405	BcsZ	4.14e-66	33	370	18	351	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	4.45e-45	37	362	1	318	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOX62898.1	2.97e-289	1	387	1	387
AUZ56606.1	8.77e-214	13	386	4	380
AWH48263.1	3.13e-213	12	385	9	385
ALJ29388.1	3.56e-213	13	386	4	380
ADV28245.1	2.93e-192	9	386	8	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2B_A	1.42e-90	42	384	4	348	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
3QXQ_A	1.11e-85	42	384	4	344	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
7F81_A	8.78e-84	42	385	8	349	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	1.39e-82	42	385	8	349	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXF_A	2.22e-82	42	384	4	344	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58935	1.98e-174	13	385	3	381	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1
Q8X5L9	1.42e-86	24	384	7	365	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	2.26e-85	24	384	7	365	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
Q8Z289	9.28e-85	42	383	26	365	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
Q8ZLB7	7.38e-84	42	383	26	365	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	0.000000	0.998137	0.001842	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002381_01623.