CAZyme Information: MGYG000002381_01561

Basic Information

• Species: Stenotrophomonas bentonitica_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas bentonitica_A
• CAZyme ID: MGYG000002381_01561
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1185	MGYG000002381_20|CGC2	130653.27	5.9327

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002381	4114425	Isolate	not provided	not provided

• Gene Location: Start: 98398; End: 101955 Strand: +

Full Sequence      

MMTHSKPVFRALVVGFYGAPNVGDEVLLDLLVRRIRELGGEPVVASIDPLLTRRMHGVDA
VQFANVGDIARALMHCDVLVMGGGGIFQDHHPFNLDAVYLPYANDISSYARPMLLARQLG
VPTIVWGQGVGPLSSAGARTLVRELFQHAVAVSVRDESSKALLRQIGVDRGILVAADPGW
LFRRYHPLPAQQAAQGAGQAQSKVLAVVVREWDKGQWKTSLVEALRAAVPEGWRIQWVAF
QAHTDGSGATSDLPLIESLRQQLPGRSNDELIAPATMDATWETITRADAVLSMRLHASIL
ALLAGKPTAGLEYDDKLSHAHAMAEMPAILRLSTDDGPERFVEAIQSLVAEAWRPDPQVV
DGLEASASAHLRLLDSCTSLPPTPLRFDAASTDWLSLWLQQALVELELTREQSQRAHELL
LFRDHQLAEQKTQNTNLTQQLVEKQTKMNEDMVRLDAAQGQLQESAKALQQIKQESAQAL
QQIKQENAQALEQIKQESAQALQQIQQQLADKQAYIDDKEVYIAILQQQIEQMQTELARS
RQETADALNLWRRLSRFLQLLRRDLVRVLAAPFKLASVWRRHGLKVALQQIPRRMKTLGV
PQTAAMQQMAEPPPSMVRPVRLERLLVIAGTLTTDGWPNRAMQFAKAGDRAGFFVRITAA
DGSAWPDDGSGMPARLAVDAHNWLQEVRAENTRVLLADGSPQALGLARSARERGAEVIVD
LAALGTDSLSAELRVLTDRVVTGTPEQKVDGVPSRFLGTAGDNEIFDSYRSHELPQAYED
GRQHVLFVVLGGDGDAWLDAALEASPDLVFHVTGMKVDGRDTRQVHALDWSWQPQQMAPL
IAGAHAVVIVGGAGDSTRLADLSMAALLLEKPVFVDALPSFAPSPNLHRVDVAKLSAQLA
GATASEDYAFIARHAWLGHVEQLMQPEYPVSVSVVVLIHNNRRIIERCVSTLLEHAGEWL
QEIVVVDNQSSDGGAELVESLYAGHAKVKLVRNSENGCSSGRNLGVKHSTGSYIAFFDSD
QWLTSPSCFSEAVNILAANPGVGTIGWNAGWFDGTRDDLGGPISDYLPNRGMNNEARIKG
YRDDVGFLGTSCMFIARDLFERLEGFDVFYDPTCFEDTDICFQVKKAGYSVAFRDLAGVR
HQPHQTTGASEGSERYKRLFNRNATYFRDKWKGYPEFFVDLKSWH

Enzyme Prediction     

No EC number prediction in MGYG000002381_01561.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	933	1102	8.3e-21	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03609	S_layer_CsaB	4.98e-60	11	329	1	293	polysaccharide pyruvyl transferase CsaB. The CsaB protein (cell surface anchoring B) of Bacillus anthracis adds a pyruvoyl group to peptidoglycan-associated polysaccharide. This addition is required for proteins with an S-layer homology domain (pfam00395) to bind. Within the larger group of proteins described by pfam04230, this model represents a distinct clade that nearly exactly follows the phylogenetic distribution of the S-layer homology domain (pfam00395). [Cell envelope, Surface structures, Protein fate, Protein and peptide secretion and trafficking]
COG2327	WcaK	2.57e-37	10	365	2	360	Polysaccharide pyruvyl transferase family protein WcaK [Cell wall/membrane/envelope biogenesis].
pfam04230	PS_pyruv_trans	3.12e-31	21	315	1	233	Polysaccharide pyruvyl transferase. Pyruvyl-transferases involved in peptidoglycan-associated polymer biosynthesis. CsaB in Bacillus anthracis is necessary for the non-covalent anchoring of proteins containing an SLH (S-layer homology) domain to peptidoglycan-associated pyruvylated polysaccharides. WcaK and AmsJ are involved in the biosynthesis of colanic acid in Escherichia coli and of amylovoran in Erwinia amylovora.
cd04186	GT_2_like_c	4.46e-27	934	1141	1	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	2.70e-22	934	1052	1	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEM49848.1	0.0	1	1185	1	1174
QGL83178.1	0.0	1	1185	1	1185
QCB33438.1	0.0	1	1185	1	1185
VEF37121.1	0.0	1	1185	1	1185
ABB07574.1	9.78e-225	1	1180	1	1222

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BCV_A	6.56e-08	932	1025	7	99	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5HEA_A	8.42e-07	932	1023	7	97	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71059	1.55e-08	932	1025	5	97	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
P71057	6.23e-07	931	1028	5	101	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
A0A0H2URH7	4.72e-06	932	1023	7	97	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002381_01561.