CAZyme Information: MGYG000002381_00327

Basic Information

• Species: Stenotrophomonas bentonitica_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas bentonitica_A
• CAZyme ID: MGYG000002381_00327
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569		63588.15	10.8379

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002381	4114425	Isolate	not provided	not provided

• Gene Location: Start: 14644; End: 16353 Strand: +

Full Sequence      

MTESLFLRRWPRVLVCLALLLALAAGIGLRQPSPPDEPRFVLAARAMVASGQWLLPHRGS
ELYAEKPPVFMWLQAASHQLFGGWTIAFLVPSLLAALLTLWLTWDLGRRLWNRRVGWWAM
LALFSCLQFGLMAKRAQIDMVLVAMTTLSLWGLLRHLLEGRNRPALWLAGFAAGLGTVTK
GVGFLPLLVLLPFAAWRWRARGAALPAGTARDLWWLLPAFLLGTAVWLAPLGVALLHSSD
PALHAYARELLFKQTGTRYANAWHHVKPAWYYLQVMATLWLPGSLLLPALVPAWWRRLKR
LDGRWWLLLGWSLLVLVFFSASPGKREVYIFPMLPALCLAAAPLLPGLLRRAGLRWLLWA
YVAVLGVAALYVGTQLWSASTWAHVQLARRAMPDTLLPVLGGWLIAFGAVLLALALWWRQ
HRAGALVVAAAFLLWNLYGWVLMPTLNPYSSASAVMQRVGKRIGPEAELGVVAWREQNLL
QADRPVTDFGFKTPWDQQWQAAGPWLSHAPRQRWLLVLDEAISPCVDPSAVIEIGSANRN
RWLLFPGTAWQADCHAAVTATDTAQDEED

Enzyme Prediction     

No EC number prediction in MGYG000002381_00327.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	8	512	1.7e-99	0.924074074074074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	4.53e-36	26	516	24	500	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	3.13e-07	66	180	2	115	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	2.95e-06	35	432	31	424	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOX61527.1	0.0	1	569	1	569
AHY58139.1	0.0	1	569	1	571
QIO89097.1	0.0	14	569	1	555
QHB72309.1	0.0	3	569	26	592
AOA73186.1	1.99e-290	47	559	1	514

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6V1N8	1.32e-25	35	457	30	427	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
B7VBN0	2.36e-25	35	434	30	413	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=arnT PE=3 SV=1
Q9HY61	3.17e-25	35	434	30	413	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arnT PE=3 SV=1
Q3KCC9	1.53e-22	35	429	48	435	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1
Q2NRV9	5.84e-20	27	419	22	407	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=arnT2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999717	0.000262	0.000024	0.000002	0.000001	0.000036

TMHMM  Annotations     

start	end
13	30
80	102
115	132
171	193
214	236
270	292
305	324
328	350
357	379
399	418
423	442