CAZyme Information: MGYG000002380_02511

Basic Information

• Species: Levilactobacillus brevis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Levilactobacillus; Levilactobacillus brevis
• CAZyme ID: MGYG000002380_02511
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
196		22514.7	9.7944

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002380	2621559	Isolate	Russia	Europe

• Gene Location: Start: 5344; End: 5934 Strand: -

Full Sequence      

MLTVGNWATPKSNSANLMRSSDVMPTAFEQFYDFSHNRQWLVIKTKMLNRLFQLSKQHKS
GLVPDFSWVTQHNANSVKGAHITNKYANDYYYNACRVPMLLAQSHDPLAQKTLTSMLHFF
AKHSTVTAGYTMSGKPLNDYQSASFSAPLLMATSWYLNQGYDSLFFHQQWIFAKAMTKHD
YYNATLTMYALMFSSI

Enzyme Prediction     

No EC number prediction in MGYG000002380_02511.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	2	193	2.4e-32	0.584375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	2.99e-06	25	193	160	318	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APT18125.1	2.63e-140	1	194	1	194
QKX08708.1	3.07e-128	1	196	176	371
QRG96281.1	3.82e-128	1	196	193	388
AOB24758.1	3.53e-127	1	196	155	350
AOB21411.1	3.53e-127	1	196	155	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1V5C_A	2.90e-10	2	162	182	355	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	2.94e-10	2	162	188	361	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29019	3.16e-09	2	162	238	411	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999865	0.000170	0.000009	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002380_02511.