CAZyme Information: MGYG000002377_00679

Basic Information

• Species: Clostridium_X cadaveris
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_X; Clostridium_X cadaveris
• CAZyme ID: MGYG000002377_00679
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
678	MGYG000002377_2|CGC2	80769.87	4.7447

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002377	3460249	Isolate	not provided	not provided

• Gene Location: Start: 77512; End: 79548 Strand: +

Full Sequence      

MRKEYVSYNGNIPVKVELLNIKEHPIHWHDAIELLMVLKGSIEVTIESDNYVVEENEIEI
INMEECHRIHSDEDNMVLMIHMDPNFFQKYYDDIKNMFFYTDTTEENIQQGDEKYEILRK
YISMIVCEVVQKGDDYDEYIEETMVELLYHLLNNFHYLIYEKEELKDNEEQLERYHRIAK
YIYNNYNNKISLQDIAEKEFLSAHYLSHEIKSTMGLSFKDFVNLTRVQESIKLLLDTDMT
ISDISLEVGFSHIRYYNKHFKKHYNMTPMQYRKMYKVDDSKLEEIKDVESYDLDIALDYL
TTFLEDYDRFNYDDKIIKISINASDVLENFDHPYKNSIWLPKAENLMDYYNRNIIKNIQK
DITFDYGRLSGLFVREFKNVKMAKDVIDFILSLDLRPDIIIDNVDKDTLRILDEFLDYFS
DEYGNYEIGKWRYTIDKRIEVDSKQKLKELLIDEWGLPAEEEEILEIQQNEIYDTSYMLP
YTIHHGLRDGKKISFLKIIDDIALSLDKNNEVFFGDSGIINWEGIRKPSYYAYQFLSRLG
DKVVAQGEGYIVTSKGDDIQILLYTYNEEMENLIKLSEINKLRGKKNIAQRNISLNITNL
FKEYKVTKYEIYERINSCYNKYLSLGSPRRLSDEEIDLIKIACNPKIDMEYRKKNTVHHL
GIKIQGYGAVLITFNAVK

Enzyme Prediction     

No EC number prediction in MGYG000002377_00679.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	468	631	1.2e-17	0.3619489559164733

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2207	AraC	1.08e-24	168	276	15	123	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	2.49e-24	189	272	1	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	6.28e-21	195	274	1	81	Helix-turn-helix domain.
PRK10371	PRK10371	3.07e-16	181	274	199	292	transcriptional regulator MelR.
NF033869	viru_reg_Rsp	2.01e-12	32	303	22	275	AraC family transcriptional regulator Rsp. Rsp (repressor of surface proteins), as described in Staphylococcus aureus, is a large protein with an AraC-like helix-turn-helix DNA-binding domain. Regulatory targets include the accessory gene regulator (agr) operon, which in turn regulates a large number of virulence factors.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATD56640.1	1.01e-230	1	678	1	689
QBJ75981.1	1.01e-230	1	678	1	689
SLK21057.1	1.01e-230	1	678	1	689
ATD55683.1	1.01e-230	1	678	1	689
AYE35030.1	5.46e-226	1	678	1	689

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3LSG_A	6.34e-11	189	272	19	102	Thecrystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_B The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_C The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_D The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_E The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum]
6SWI_A	1.64e-09	177	273	9	106	TheC-terminal domain of AraT, a response regulator from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4M29_A	2.14e-08	513	650	334	471	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	3.73e-08	513	650	334	471	ChainA, Beta-xylosidase [Caulobacter vibrioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HJR8	4.27e-15	37	312	28	299	Uncharacterized HTH-type transcriptional regulator SACOL0084 OS=Staphylococcus aureus (strain COL) OX=93062 GN=SACOL0084 PE=4 SV=2
Q6GKK1	1.29e-14	37	272	28	254	Uncharacterized HTH-type transcriptional regulator SAR0107 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=SAR0107 PE=4 SV=1
Q7A882	1.70e-14	37	332	28	316	Uncharacterized HTH-type transcriptional regulator SA0097 OS=Staphylococcus aureus (strain N315) OX=158879 GN=SA0097 PE=4 SV=1
Q6GD21	1.70e-14	37	332	28	316	Uncharacterized HTH-type transcriptional regulator SAS0078 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=SAS0078 PE=4 SV=1
Q8NYT6	1.70e-14	37	332	28	316	Uncharacterized HTH-type transcriptional regulator MW0077 OS=Staphylococcus aureus (strain MW2) OX=196620 GN=MW0077 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002377_00679.