CAZyme Information: MGYG000002375_02200

Basic Information

• Species: Clostridium_G tetani
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_G; Clostridium_G tetani
• CAZyme ID: MGYG000002375_02200
• CAZy Family: CBM54
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584	MGYG000002375_16|CGC1	64534.7	7.3835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002375	2890495	Isolate	China	Asia

• Gene Location: Start: 62750; End: 64504 Strand: +

Full Sequence      

MKRNFIIALIASMLSTSFTSLGKVQASDISHERYWGKDRYETSIKISQKGWENGAKYVVL
ASGQGYADALSASPFAKLIDAPILLTKGDKLEEKTLQEIKRLNPSKVYIIGGEGSISQHI
EDEIKSKISNDVERFKGEDRYETSMKMAQRFPNKEKVILASGEGYADALSAAPIAAINSM
PIILTPRDRLPKLAEDYLKKDEVKTIYIIGGTASISDTIEKELPLSIRIYGKDRFETNAE
IIRNFILDFDYKNAYIALGAGETGNEFADALTGAVVAAKDRAPVLLTGKNLNSSTKAISN
EVLFPHTKFKVLGGANNVSDKLVEDIKVTITDNFLNKDKEYTRNTPGNAMISEDGIRLKN
SKIKGNLYVESDDVSLKNVEISGTIYLDPGRKGQTRLEKVKADKIIVLSARNENDGIYLE
DVDANLLEIKSGTKAKISIRRGTDLKKIKVLANTLIENYQGDYKEIIIPKTPNYKELELT
GSFTENIIVEGQIELKTIGGAYVTDVLIKTNKEDVVILDGKFDDVKVYTAADIKITEKAS
ARIFGETIEAQTKAEIYVPKGADVNIRRIRPHNITGDGKDNALN

Enzyme Prediction     

No EC number prediction in MGYG000002375_02200.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033435	S-layer_Clost	2.36e-32	36	279	389	661	S-layer protein SlpA. In Clostridiodes difficile, the S-layer protein precursor, SlpA, is one member of a large paralogous family of protein that share several cell wall-binding repeats. SlpA is cleaved into a larger and smaller protein. The S-layer protein itself is important to adhesion, and portions of it are highly variable, and then N-terminal and C-terminal are well-conserved.
pfam04122	CW_binding_2	1.96e-25	33	118	1	79	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.
pfam04122	CW_binding_2	2.21e-24	134	218	1	80	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.
COG2247	LytB	1.68e-21	58	237	30	250	Putative cell wall-binding domain [Cell wall/membrane/envelope biogenesis].
pfam04122	CW_binding_2	1.91e-18	228	321	1	80	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBD84237.1	0.0	1	584	1	584
SNV68240.1	0.0	1	584	1	584
QBD84238.1	3.49e-152	14	583	4	569
AKA68908.1	1.95e-105	2	511	4	515
ALU38329.1	2.86e-65	7	326	4	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5J72_A	1.18e-43	36	355	137	459	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
5J6Q_A	2.90e-34	36	328	291	593	ChainA, Cell wall binding protein cwp8 [Clostridioides difficile 630]
7ACY_B	4.27e-31	36	302	45	344	ChainB, S-layer protein [Clostridioides difficile 630],7ACY_D Chain D, S-layer protein [Clostridioides difficile 630],7QGQ_B Chain B, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_D Chain D, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_J Chain J, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_K Chain K, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_L Chain L, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_M Chain M, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_N Chain N, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_T Chain T, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_U Chain U, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_V Chain V, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_W Chain W, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_X Chain X, Precursor of the S-layer proteins [Clostridioides difficile 630]
7ACX_B	5.82e-31	36	302	45	344	ChainB, S-layer protein [Clostridioides difficile],7ACX_D Chain D, S-layer protein [Clostridioides difficile]
7ACZ_B	8.32e-31	36	342	45	380	ChainB, SLPH (HMW SLP) [Clostridioides difficile R20291],7ACZ_D Chain D, SLPH (HMW SLP) [Clostridioides difficile R20291]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02114	4.64e-40	27	327	24	314	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1
Q02113	8.20e-36	12	301	42	319	Amidase enhancer OS=Bacillus subtilis (strain 168) OX=224308 GN=lytB PE=1 SV=1
Q9UYS2	2.17e-13	52	223	25	197	Uncharacterized protein PYRAB14350 OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=PYRAB14350 PE=3 SV=1
O58348	1.28e-11	58	223	30	197	Uncharacterized protein PH0614 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=PH0614 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000393	0.996913	0.002009	0.000275	0.000218	0.000167

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002375_02200.