CAZyme Information: MGYG000002374_00460

Basic Information

• Species: Campylobacter testudinum
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter; Campylobacter testudinum
• CAZyme ID: MGYG000002374_00460
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		38278.02	8.3757

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002374	1770849	Isolate	United States	North America

• Gene Location: Start: 152267; End: 153292 Strand: -

Full Sequence      

MRILVSCLETSANLHLSEVLEHLKDSEICGIFDKKFGEALYDSKEFSAMGFVEILPLIFK
AKKALKQMVKLAKNCDKVLLIDSPAFNLPLAKAIKEAGLKCKVTYYILPQVWAWKSGRVA
KVEKYCDNLASILPFDALFYSRSHYVGHPLLDEIKVQKKELSNSEIIAFLPGSRKSEITR
LMPIYKEVASSLNGKKLLVVPPNLKDDIDEIYGDVSEFQVVFDTHKALLQSEFAFVCSGT
ATLEAALIGTPFVLCYKAKAIDIWLARKLVKLKHVGLANIMFDFIGKDALNVELIAEQVT
KEALLNEYKNCDRSKFLQACDELRSYLKHGSSKKVADMILS

Enzyme Prediction     

EC	2.4.1.182

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	313	3.9e-93	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14089	PRK14089	0.0	1	339	2	344	lipid-A-disaccharide synthase.
COG0763	LpxB	3.95e-105	1	340	2	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.44e-87	3	336	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.30e-81	3	339	8	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK00025	lpxB	3.80e-79	1	340	2	372	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJB44976.1	1.32e-246	1	341	1	341
AVK80598.1	1.32e-246	1	341	1	341
AGZ81220.1	1.84e-246	1	341	10	350
ALV64314.1	1.84e-246	1	341	10	350
QKF56262.1	1.08e-225	1	341	1	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	8.43e-26	21	304	31	337	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	8.43e-26	21	304	31	337	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FK76	8.90e-120	4	339	5	361	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) OX=407148 GN=lpxB PE=3 SV=1
Q5HWH9	8.90e-120	4	339	5	361	Lipid-A-disaccharide synthase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=lpxB PE=3 SV=1
Q9PIK8	1.02e-118	4	339	5	361	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=lpxB PE=3 SV=1
Q9ZKY2	1.50e-104	3	337	4	351	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) OX=85963 GN=lpxB PE=3 SV=1
O25537	8.57e-104	3	337	4	351	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002374_00460.