CAZyme Information: MGYG000002368_02794

Basic Information

• Species: Vibrio metoecus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio metoecus
• CAZyme ID: MGYG000002368_02794
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426		47548.24	9.2885

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002368	3946363	Isolate	United States	North America

• Gene Location: Start: 27846; End: 29126 Strand: +

Full Sequence      

MLLRTLYTLLLTLAAPFLLYGLYRHKQGKPNVGKRWKEHFGITPPLKTTTPPIWIHAASV
GETLAITPLIKQIKQRSPNTPILLTTTTPTGAEQAEKLANWIEHRYTPIDFSFAVRGFLR
RIRPCQLIIVETELWPNTLHTVAKAGLPITLVNARLSEKSYRGYQRIRPLFNRMAKQLSL
VLCQFEDDAQRFIQLGIAEPKIKITGSIKFDISITDELIAQGEALRTALGNHRPVWIAAS
THQGEDEIVLTAHQEILKQHPDTLLILVPRHPERFAAVHKLAASLFSVQTRSSQQTIASD
TQVYLGDTMGEMLVLLGASDVCFMGGSLVGKKVGGHNLLEPAALAKPIITGPSFYNFTDI
THALMNAHACVIADQPETIVKQVNHWFADVQERQQCGKNALEIVMQNRGALENTLIELGF
TKEFVQ

Enzyme Prediction     

EC	2.4.99.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	34	212	3.2e-68	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1519	KdtA	0.0	14	418	12	415	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
PRK05749	PRK05749	0.0	14	415	13	414	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
pfam04413	Glycos_transf_N	6.06e-69	37	212	1	176	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
pfam00534	Glycos_transf_1	1.95e-04	247	402	18	157	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUY00585.1	2.17e-304	1	426	1	426
AOW83807.1	5.48e-298	1	426	1	426
ATD28533.1	2.23e-297	1	426	1	426
AKB04319.1	2.60e-296	1	426	1	426
QXC57413.1	2.60e-296	1	426	1	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BFC_A	1.26e-28	232	412	41	221	ChainA, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AC75	2.36e-107	3	415	2	413	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1
P0AC77	2.36e-107	3	415	2	413	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1
P0AC76	2.36e-107	3	415	2	413	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1
P44806	1.32e-95	4	415	3	416	3-deoxy-D-manno-octulosonic acid transferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=waaA PE=1 SV=1
Q45374	3.32e-55	4	415	3	420	3-deoxy-D-manno-octulosonic acid transferase OS=Bordetella pertussis OX=520 GN=waaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000019	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002368_02794.