CAZyme Information: MGYG000002366_01578

Basic Information

• Species: Salmonella enterica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Salmonella; Salmonella enterica
• CAZyme ID: MGYG000002366_01578
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548	MGYG000002366_1|CGC19	61835.06	9.3206

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002366	4955431	Isolate	United States	North America

• Gene Location: Start: 1649188; End: 1650834 Strand: -

Full Sequence      

MMKSIRYYLAFAAFIALYYVIPVNSRLLWQPDETRYAEISREMLASGDWIVPHFLGLRYF
EKPIAGYWINSLGQWLFGATNFGVRAGAILTTLLAAALVAWLTFRLWRDKRTALLASVIF
LSLFAVYSIGTYAVLDPMIALWLTTGMCCFWQGMQATTRTGKIGMFLLLGATCGLGVLTK
GFLALAVPVVSVLPWVIVQKRWKDFLLYGWLAVLSCFVVVLPWAIAIARREADFWHYFFW
VEHIQRFAMSDAQHKAPFWYYLPVLLAGSLPWLGLLPGALKLGWRERNGAFYLLGWTIMP
LLFFSIAKGKLPTYVLSCFAPIAILMARFVLHNVKEGIAALRVNGGINLVFGLVGIVAAF
VISSWGPLKSPVWTHIETYKVFCVWGVFTVWAFVGWYSLCHSQQYLLPAFCPLGLALLFG
FSIPDRVMESKQPQFFVEMTQAPLASSRYILADNVGVAAGLAWSLKRDDIMLYGHAGELR
YGLSYPDVQDKFVKADDFNAWLNQHRQEGIITLVLSIAKDEDISALSLPPADNVDYQGRL
VLIQYRPK

Enzyme Prediction     

No EC number prediction in MGYG000002366_01578.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	518	1.7e-151	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	0.0	1	547	1	552	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	1.89e-105	1	521	2	535	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	2.30e-46	4	238	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	4.82e-05	62	225	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMZ06672.1	0.0	1	548	1	548
AMY78259.1	0.0	1	548	1	548
ALO91025.1	0.0	1	548	1	548
AMY73869.1	0.0	1	548	1	548
QQI83495.1	0.0	1	548	1	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.67e-30	11	325	37	359	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5R274	0.0	1	548	1	548	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=arnT PE=3 SV=1
C0Q067	0.0	1	548	1	548	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella paratyphi C (strain RKS4594) OX=476213 GN=arnT PE=3 SV=1
B5RCC6	0.0	1	548	1	548	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=arnT PE=3 SV=1
O52327	0.0	2	548	1	547	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=arnT PE=1 SV=2
B5FNU1	0.0	1	548	1	548	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella dublin (strain CT_02021853) OX=439851 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999974	0.000041	0.000005	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
7	29
82	104
113	135
176	198
205	227
257	276
289	307
312	331
344	366
381	400
405	424