CAZyme Information: MGYG000002365_00141

Basic Information

• Species: Bifidobacterium globosum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium globosum
• CAZyme ID: MGYG000002365_00141
• CAZy Family: GH1
• CAZyme Description: Bifunctional beta-D-glucosidase/beta-D-fucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	MGYG000002365_1|CGC5	51788.14	4.6445

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002365	2036949	Isolate	Kenya	Africa

• Gene Location: Start: 153062; End: 154444 Strand: +

Full Sequence      

MTMIFPKGFMFGTATAAYQIEGAVAEGGRTPSIWDTFSHTGHTLNGDTGDVADDFYHRWE
DDLKLLRDLGVNAYRFSIGIPRVIPTPDGKPNQEGLDFYSRIVDRLLEYGIAPIVTLYHW
DLPQYMASEDGREGGWLERETAYRIADYAGIVAKCLGDRVHTYTTLNEPWCATYLSYGGT
EQAPGLGAGPLAFRTVHHINLAHGLMCQAVRAEAGGKPELSVTCNLQVCRGDADAVHRLD
LIANRAFLDPMLRGRYPQELFAITKGICDWDFIRDGDLALINQPIDALGLNYYSTNLVKM
SDRPQFPQSTEVSTAPGASDIDWLPTAGPHTEMGWNIDPDALYETLVRLNDNYPGMPLVV
TENGMACPDEVEVGPDGVKMVHDNDRIDYLRRHLEAVYRAVEEGTDVRGYFAWSLMDNFE
WAFGYSKRFGLTYVDYESQERIKKDSFEWYRRFIADHSAR

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.23	3.2.1.74	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	457	2.6e-152	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03356	BGL	0.0	6	450	1	426	beta-galactosidase.
pfam00232	Glyco_hydro_1	6.71e-171	5	457	5	451	Glycosyl hydrolase family 1.
COG2723	BglB	1.01e-156	2	455	1	451	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK13511	PRK13511	1.26e-107	1	452	1	461	6-phospho-beta-galactosidase; Provisional
PLN02814	PLN02814	1.38e-72	5	454	28	480	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIZ15630.1	0.0	1	460	1	460
ASW23821.1	0.0	1	460	1	460
CBG21199.1	0.0	1	460	1	460
BAA19881.1	0.0	1	460	1	460
ATU20089.1	0.0	5	460	5	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GNX_A	1.24e-166	3	450	16	467	b-glucosidasefrom Streptomyces sp [Streptomyces sp.],1GNX_B b-glucosidase from Streptomyces sp [Streptomyces sp.],1GON_A b-glucosidase from Streptomyces sp [Streptomyces sp.],1GON_B b-glucosidase from Streptomyces sp [Streptomyces sp.]
7BBS_A	1.05e-158	5	457	20	481	ChainA, Beta-glucosidase Bg10 [uncultured bacterium],7BBS_B Chain B, Beta-glucosidase Bg10 [uncultured bacterium]
6ZIV_AAA	3.62e-137	5	457	15	453	ChainAAA, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_BBB Chain BBB, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_CCC Chain CCC, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_DDD Chain DDD, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_EEE Chain EEE, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_FFF Chain FFF, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_GGG Chain GGG, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_HHH Chain HHH, Beta-glucosidase [Alicyclobacillus tengchongensis]
6Z1H_A	4.60e-136	5	457	11	448	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
1NP2_A	7.34e-132	9	455	8	427	Crystalstructure of thermostable beta-glycosidase from thermophilic eubacterium Thermus nonproteolyticus HG102 [Thermus nonproteolyticus],1NP2_B Crystal structure of thermostable beta-glycosidase from thermophilic eubacterium Thermus nonproteolyticus HG102 [Thermus nonproteolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94248	0.0	1	460	1	460	Bifunctional beta-D-glucosidase/beta-D-fucosidase OS=Bifidobacterium breve OX=1685 PE=1 SV=1
P10482	1.04e-122	1	458	1	455	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
P38645	1.84e-122	5	460	38	470	Thermostable beta-glucosidase B OS=Thermobispora bispora OX=2006 GN=bglB PE=1 SV=1
P22505	3.33e-122	2	455	5	444	Beta-glucosidase B OS=Paenibacillus polymyxa OX=1406 GN=bglB PE=1 SV=1
Q03506	1.88e-116	4	455	5	444	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999929	0.000138	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002365_00141.