CAZyme Information: MGYG000002361_00527

Basic Information

• Species: Lentilactobacillus senioris
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus senioris
• CAZyme ID: MGYG000002361_00527
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	MGYG000002361_4|CGC7	50538.63	9.6202

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002361	1566713	Isolate	Japan	Asia

• Gene Location: Start: 480109; End: 481497 Strand: +

Full Sequence      

MTTRLGKALLGLGLVGGMLMAGGATASADTTLSEKPAGTMGSSYPVQQYNAFAKSRVSIS
RSNSVPDLSEWQGSFTDAQVKKLKDQVPFVILRVQYGSDYKDKTFNHNVALMQKYGVPYG
VYSFSQYSSASDAKTEARDLYNRAPDAEFYVNDYEDQTSSGNTNTAATNWYNTIKPLAGS
RKVLLYSYASFMQSYASKAVKDYDGFWLAAYQTSEPTTASHVLWQYTDSYYMSSLGQSVD
ASVSTSKDSSWFLSGASTGSDSNTGSDNSGDTDNTGSTDPDDSTGSNNSNSTTKPSSNFN
YVNIDSQFTVKNNPGHNFFNHIPNEGRYSYKKLHNGSAYAGKNITVDSQGTIKSGSSHSY
YRAYYKGKKIGWIYDKALAAKITYTSPSLKVKVKANPTSNFYNHITNSKYTVKKTHNGSA
YAGKTLTVNAAGVKYGWKTPYYRAYYNGKLVGWIYGASVDVK

Enzyme Prediction     

No EC number prediction in MGYG000002361_00527.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	67	233	9.3e-35	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06523	GH25_PlyB-like	7.98e-52	65	242	2	175	PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis. PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b. Both domains are required for effective catalytic activity. Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny. Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	8.69e-25	65	243	2	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06414	GH25_LytC-like	2.22e-21	67	244	5	190	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
pfam01183	Glyco_hydro_25	6.97e-19	67	235	2	180	Glycosyl hydrolases family 25.
cd06522	GH25_AtlA-like	2.72e-14	67	243	5	190	AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYU53475.1	1.38e-127	62	459	32	400
ALJ30817.1	4.04e-127	62	459	32	401
QYU54863.1	6.19e-124	62	459	32	402
AYF92825.1	9.50e-112	63	455	35	396
QYU53167.1	7.92e-102	62	457	35	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HMC_A	1.57e-16	67	256	9	192	Endolysinfrom Bacillus anthracis [Bacillus anthracis]
2NW0_A	1.28e-13	65	252	3	183	ChainA, PlyB [Bacteriophage sp.],2NW0_B Chain B, PlyB [Bacteriophage sp.]
2WW5_A	1.56e-10	56	243	262	466	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	1.56e-10	56	243	262	466	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
4JZ5_A	3.67e-09	65	246	25	214	High-resolutionstructure of catalytic domain of endolysin ply40 from bacteriophage P40 of Listeria monocytogenes [Listeria phage P40]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000354	0.998666	0.000457	0.000186	0.000168	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002361_00527.