CAZyme Information: MGYG000002359_02795

Basic Information

• Species: Mycobacterium tuberculosis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium tuberculosis
• CAZyme ID: MGYG000002359_02795
• CAZy Family: GT87
• CAZyme Description: Alpha-(1->3)-arabinofuranosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433		48914.8	9.8269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002359	4387829	Isolate	Sweden	Europe

• Gene Location: Start: 350635; End: 351936 Strand: +

Full Sequence      

MYGALVTAADSIRTGLGASLLAGFRPRTGAPSTATILRSALWPAAVLSVLHRSIVLTTNG
NITDDFKPVYRAVLNFRRGWDIYNEHFDYVDPHYLYPPGGTLLMAPFGYLPFAPSRYLFI
SINTAAILVAAYLLLRMFNFTLTSVAAPALILAMFATETVTNTLVFTNINGCILLLEVLF
LRWLLDGRASRQWCGGLAIGLTLVLKPLLGPLLLLPLLNRQWRALVAAVVVPVVVNVAAL
PLVSDPMSFFTRTLPYILGTRDYFNSSILGNGVYFGLPTWLILFLRILFTAITFGALWLL
YRYYRTGDPLFWFTTSSGVLLLWSWLVMSLAQGYYSMMLFPFLMTVVLPNSVIRNWPAWL
GVYGFMTLDRWLLFNWMRWGRALEYLKITYGWSLLLIVTFTVLYFRYLDAKADNRLDGGI
DPAWLTPEREGQR

Enzyme Prediction     

No EC number prediction in MGYG000002359_02795.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	95	322	4.8e-18	0.9783549783549783

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09594	GT87	1.55e-26	94	323	1	233	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALA79217.1	2.81e-315	1	433	1	433
CCP45471.1	2.81e-315	1	433	1	433
AOT73669.1	2.81e-315	1	433	1	433
ALB19877.1	2.81e-315	1	433	1	433
AIH96388.1	2.81e-315	1	433	1	433

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMZ6	5.61e-316	1	433	1	433	Alpha-(1->3)-arabinofuranosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=aftC PE=3 SV=1
P9WMZ7	5.61e-316	1	433	1	433	Alpha-(1->3)-arabinofuranosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=aftC PE=1 SV=1
A0QW28	2.07e-211	1	429	1	425	Alpha-(1->3)-arabinofuranosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=aftC PE=1 SV=1
Q8NPB7	3.51e-89	35	400	22	384	Alpha-(1->3)-arabinofuranosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=aftC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998229	0.001750	0.000013	0.000004	0.000003	0.000006

TMHMM  Annotations     

start	end
113	135
163	185
195	217
224	243
279	301
310	332
352	374
386	408